Gene Information

Name : cusR (Gbem_3465)
Accession : YP_002140254.1
Strain : Geobacter bemidjiensis Bem
Genome accession: NC_011146
Putative virulence/resistance : Virulence
Product : heavy metal transcriptional response regulator CusR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3979834 - 3980505 bp
Length : 672 bp
Strand : -
Note : -

DNA sequence :
ATGTACTTTTTGATCGTGGAAGACGCGGAAAAAACCGCTGAACAGTTGCGCAGAGGATTGTCGGAGATGTCGGTGACGGT
GGACGTCGCATCCGACGGGCTCAAGGGGCTGGCGATGGCCCGGGAGAGGGACTACGACCTGATCGTCCTCGACCTTATGC
TCCCCGGCATCGACGGGTTCGAGGTGGTGAAGCGGTTGCGCGAAGGGGGATCTACCACTCCGGTCATGATCCTTACCGCG
CGCGACGAGGTGCACGACCGCATCACCGGGCTGCAGCTTGGGGCGGACGACTACCTGGTCAAGCCGTACTCTTTCGCCGA
ACTTTGCGCCCGGGTCCAGGCGCTGTTGCGCCGGGGACAGGTGGTGCAGCAGGACGAGATACAGGTGGCGGACCTTACCG
TCAACTTCTTCGCCCACAAGGCGACCCGCGCGGGGAAGAACCTGGAACTCACCCCGAAGGAGTTCGCCCTGCTCTCCCTG
CTGATCCGGCGGGCGGGAGAGGTGCAAAGCCGGTTGAGGATTGCCGAGCGGGTGTGGAACCTCGGCTTCGACGCCAACCT
GAAGATCGTCGACGTCAAGGTAGCCGCCCTGAGGGCCAAGGTGGACGGGCCTTACGAGAAGAAGCTGATACACACGGTGC
GCGGCTTGGGGTACATACTTGAAGATCGGTAA

Protein sequence :
MYFLIVEDAEKTAEQLRRGLSEMSVTVDVASDGLKGLAMARERDYDLIVLDLMLPGIDGFEVVKRLREGGSTTPVMILTA
RDEVHDRITGLQLGADDYLVKPYSFAELCARVQALLRRGQVVQQDEIQVADLTVNFFAHKATRAGKNLELTPKEFALLSL
LIRRAGEVQSRLRIAERVWNLGFDANLKIVDVKVAALRAKVDGPYEKKLIHTVRGLGYILEDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-46 50
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-45 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR BAC0197 Protein 5e-54 53
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR BAC0125 Protein 4e-52 52
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR BAC0083 Protein 2e-53 51
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR BAC0111 Protein 1e-53 50
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR BAC0308 Protein 2e-50 49
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR BAC0347 Protein 2e-48 49
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR BAC0638 Protein 1e-43 48
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_010079.5776364.p0 Protein 4e-35 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_002952.2859858.p0 Protein 4e-35 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_007622.3794948.p0 Protein 4e-35 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_003923.1003417.p0 Protein 4e-35 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_013450.8614146.p0 Protein 4e-35 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_002951.3238224.p0 Protein 4e-35 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_007793.3914065.p0 Protein 4e-35 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_002758.1121390.p0 Protein 4e-35 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_002952.2859905.p0 Protein 2e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_009782.5559369.p0 Protein 3e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_002951.3237708.p0 Protein 3e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_003923.1003749.p0 Protein 3e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_002758.1121668.p0 Protein 3e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_007622.3794472.p0 Protein 2e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_009641.5332272.p0 Protein 3e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_013450.8614421.p0 Protein 3e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_007793.3914279.p0 Protein 3e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR NC_002745.1124361.p0 Protein 3e-34 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR BAC0487 Protein 7e-28 41
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR AE000516.2.gene3505. Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR VFG0596 Protein 5e-47 50
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR VFG0473 Protein 6e-31 47
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR VFG1390 Protein 6e-38 42
cusR YP_002140254.1 heavy metal transcriptional response regulator CusR VFG1389 Protein 1e-32 42