Gene Information

Name : AnaeK_3965 (AnaeK_3965)
Accession : YP_002136300.1
Strain : Anaeromyxobacter sp. K
Genome accession: NC_011145
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4472812 - 4473213 bp
Length : 402 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: mxa:MXAN_4117 transposase orf1, IS66 family

DNA sequence :
GTGATCACGATTCCGCGGTCGGTCCGCATCTTCATCGGCTCGACCCCGATCGACATGCGGAAGTCGATCGATGGGCTGAT
GGCGATCGTGCAGGGCGAACTCCGCCAGGACGCGTACTCCGGTCACCTCTTCGTCTTCGTGTCGCGTCGCTGCGACCGGG
TGAAGATCCTCACCTGGGACAAGGGCGGGTTCGTCCTCGTGTACAAGCGGCTGGAGCGCGGCCAGTTCAAGCTGCCTCAC
ATGGACTCGTCCACGATGGCCGTCGAGATCGACGCGACGCAGCTCGCGATGCTGCTCGACGGGATCGACTTCGGCCGCGT
TCGGCGGCCCGAGCACTGGCAGCCCCCGTCCCACTCGGATCGTCCCGGTGGTCGTCCCATGGACAAGCCCGCTCCGGCGT
GA

Protein sequence :
MITIPRSVRIFIGSTPIDMRKSIDGLMAIVQGELRQDAYSGHLFVFVSRRCDRVKILTWDKGGFVLVYKRLERGQFKLPH
MDSSTMAVEIDATQLAMLLDGIDFGRVRRPEHWQPPSHSDRPGGRPMDKPAPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-14 47
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-14 47
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 7e-15 47
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 7e-15 47
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-14 45
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-16 43
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-16 43
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-15 43
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-14 42
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-14 42
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 8e-14 42
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-14 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 8e-14 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-14 42
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-14 42
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-14 42
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-14 42
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-14 42
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-14 42
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-14 42
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-17 41
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 2e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AnaeK_3965 YP_002136300.1 IS66 Orf2 family protein VFG1737 Protein 4e-15 45
AnaeK_3965 YP_002136300.1 IS66 Orf2 family protein VFG1052 Protein 3e-15 43
AnaeK_3965 YP_002136300.1 IS66 Orf2 family protein VFG1709 Protein 4e-15 42
AnaeK_3965 YP_002136300.1 IS66 Orf2 family protein VFG1698 Protein 3e-15 42
AnaeK_3965 YP_002136300.1 IS66 Orf2 family protein VFG0792 Protein 4e-15 42