Gene Information

Name : phoB (PHZ_c0507)
Accession : YP_002129350.1
Strain : Phenylobacterium zucineum HLK1
Genome accession: NC_011144
Putative virulence/resistance : Virulence
Product : phosphate regulon response regulator PhoB
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 532937 - 533629 bp
Length : 693 bp
Strand : +
Note : -

DNA sequence :
GTGACGACGCCACGCATACTGATCGTCGAGGACGAGGACTCGCTCGCGACGCTGCTTCAGTACAACCTCGAGAAGGAGGG
CTACGAGGTCGCCGCCGCCGGCGACGGCGAGGAGGCCCTGCTGCAGGTGCAGGAGCGCCTGCCCGACCTCATCGTGCTGG
ACTGGATGCTGCCCAAGGTGTCGGGCATCGAGGTGTGCCGGCGGCTGCGTCAGCGTCCCGAGAGCCGCAACGTGCCGATC
ATCATGCTGACGGCGCGGGGCGAGGAGACCGACCGCATCCGCGGCCTGGACACCGGCGCCGACGACTATGTGGTCAAGCC
CTTCGCCATGAGCGAGCTGGCGGCCCGCATCCGCGCGGTGCTGCGCCGGCTGCGCCCGGGCCTGGCCGAGGACCGCGTCC
GCTGCGGCGACATCATCATCGACCGGGTCGCCCACCGCGTGAAGCGGAACGGCGCGGAGGTGCACCTGGGCCCCACCGAG
TTCCGGCTGCTGGACCACTTCATGCAGCATCCCGGGCGGGTGTTCTCGCGCGAGCAGCTGCTGGACGCCGTCTGGGGGTC
GGACGTCTATGTCGAGGCCCGGACCGTCGACGTGCACATCGGGCGCCTGCGCAAGGCCCTGAACGCGGCGGACGCGGGCG
ACCCGATCCGCACGGTCCGCTCGGCCGGCTACTCGCTGGACGTCGACGCCTGA

Protein sequence :
MTTPRILIVEDEDSLATLLQYNLEKEGYEVAAAGDGEEALLQVQERLPDLIVLDWMLPKVSGIEVCRRLRQRPESRNVPI
IMLTARGEETDRIRGLDTGADDYVVKPFAMSELAARIRAVLRRLRPGLAEDRVRCGDIIIDRVAHRVKRNGAEVHLGPTE
FRLLDHFMQHPGRVFSREQLLDAVWGSDVYVEARTVDVHIGRLRKALNAADAGDPIRTVRSAGYSLDVDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_002129350.1 phosphate regulon response regulator PhoB HE999704.1.gene2815. Protein 4e-36 46
phoB YP_002129350.1 phosphate regulon response regulator PhoB AE000516.2.gene3505. Protein 3e-37 45
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_002951.3238224.p0 Protein 1e-34 44
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_007793.3914065.p0 Protein 1e-34 44
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_002758.1121390.p0 Protein 1e-34 44
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_010079.5776364.p0 Protein 1e-34 44
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_002952.2859858.p0 Protein 1e-34 44
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_007622.3794948.p0 Protein 1e-34 44
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_003923.1003417.p0 Protein 1e-34 44
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_013450.8614146.p0 Protein 1e-34 44
phoB YP_002129350.1 phosphate regulon response regulator PhoB AE015929.1.gene1106. Protein 4e-29 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_002952.2859905.p0 Protein 7e-38 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_002745.1124361.p0 Protein 1e-37 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_009782.5559369.p0 Protein 1e-37 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_002951.3237708.p0 Protein 1e-37 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_003923.1003749.p0 Protein 9e-38 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_002758.1121668.p0 Protein 1e-37 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_009641.5332272.p0 Protein 1e-37 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_013450.8614421.p0 Protein 1e-37 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_007793.3914279.p0 Protein 1e-37 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_007622.3794472.p0 Protein 7e-38 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB CP000647.1.gene2531. Protein 7e-31 43
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_010400.5986590.p0 Protein 1e-31 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB HE999704.1.gene1528. Protein 1e-33 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_011595.7057856.p0 Protein 3e-32 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_010410.6002989.p0 Protein 3e-32 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB CP001485.1.gene721.p Protein 4e-31 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_012469.1.7685629. Protein 8e-35 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB BAC0039 Protein 3e-31 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB CP000034.1.gene2186. Protein 3e-31 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB NC_002695.1.916589.p Protein 3e-31 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB AE016830.1.gene1681. Protein 2e-31 41
phoB YP_002129350.1 phosphate regulon response regulator PhoB CP001918.1.gene3444. Protein 3e-30 41
phoB YP_002129350.1 phosphate regulon response regulator PhoB BAC0596 Protein 2e-30 41
phoB YP_002129350.1 phosphate regulon response regulator PhoB CP001138.1.gene2239. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_002129350.1 phosphate regulon response regulator PhoB VFG1563 Protein 1e-32 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB VFG1702 Protein 1e-33 42
phoB YP_002129350.1 phosphate regulon response regulator PhoB VFG1390 Protein 9e-32 42