Gene Information

Name : PHZ_c1495 (PHZ_c1495)
Accession : YP_002130335.1
Strain : Phenylobacterium zucineum HLK1
Genome accession: NC_011144
Putative virulence/resistance : Resistance
Product : transcriptional regulator, MerR family
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1702657 - 1703076 bp
Length : 420 bp
Strand : -
Note : -

DNA sequence :
ATGGCGGACACCGCGATACCCATCGGCGAGCTCTCGCGCCGCACCGGCTGCAACATCGAGACGATCCGCTACTACGAGCG
GATCGGCCTCTTGCCCGCCCCGCCGCGACGCGGCCGCTACCGCAGCTATGGGGCAGAAGACGTGGGCCGGCTGGGCTTCG
TGCGCCGGGCCCGCGAGCTGGGCTTCACGCTGGACGAGGTGCGCGCCCTCCTGGGGCTCGCCGCCGGCGGGCAGTCCGCC
TGCGCCGAGGTGCGTGAGCTCGCCGGGTCGCACCTGAAGGACGTGCGGGCGCGGATCGCCGACCTCAGGCGGATGGAACG
GGTGCTCGCCGACTCCGTCCGAGCCTGCGACGCGGGGCTGGACCCCGGCTGTCCGCTCATCCTGGCGCTCTACGCGGAGG
CCCCGGCGAAGCCTGGTTAG

Protein sequence :
MADTAIPIGELSRRTGCNIETIRYYERIGLLPAPPRRGRYRSYGAEDVGRLGFVRRARELGFTLDEVRALLGLAAGGQSA
CAEVRELAGSHLKDVRARIADLRRMERVLADSVRACDAGLDPGCPLILALYAEAPAKPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-20 50
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-20 48
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 5e-20 48
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 7e-20 48
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-19 47
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-19 47
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-19 47
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-19 47
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-19 45
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-19 45
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 7e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PHZ_c1495 YP_002130335.1 transcriptional regulator, MerR family BAC0687 Protein 3e-19 48
PHZ_c1495 YP_002130335.1 transcriptional regulator, MerR family BAC0232 Protein 3e-19 48
PHZ_c1495 YP_002130335.1 transcriptional regulator, MerR family BAC0684 Protein 3e-20 48
PHZ_c1495 YP_002130335.1 transcriptional regulator, MerR family BAC0683 Protein 4e-20 47
PHZ_c1495 YP_002130335.1 transcriptional regulator, MerR family BAC0689 Protein 7e-19 47
PHZ_c1495 YP_002130335.1 transcriptional regulator, MerR family BAC0688 Protein 3e-20 46
PHZ_c1495 YP_002130335.1 transcriptional regulator, MerR family BAC0686 Protein 2e-20 44
PHZ_c1495 YP_002130335.1 transcriptional regulator, MerR family BAC0682 Protein 9e-20 42