Gene Information

Name : PHZ_c1428 (PHZ_c1428)
Accession : YP_002130270.1
Strain : Phenylobacterium zucineum HLK1
Genome accession: NC_011144
Putative virulence/resistance : Resistance
Product : transcriptional regulator, MerR family
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1620085 - 1620537 bp
Length : 453 bp
Strand : -
Note : -

DNA sequence :
ATGCCGGCGCACACCATCGGAAAGCTCGCCAAAGCGGCGGACGTGAAGGTCCCGACGATTCGCTTCTATGAGCAGATCGG
CCTGCTGCCGGAACCGGACCGCACGGAGAGCGACCGACGCGTCTACGGCGACGAGGCCGTCCGCCGCCTCGCCTTCATCA
AGCATGCCCGGCAGCTCGGCTTCCCCATCGAAGCGATCCGCACCCTCCTCGACCTGGCCGACAACCCCGACCGCACGTGC
GAGGACGCCAATGCCCTGGCCCAGGAGCAGCTCACGGCCGTCGAGACCAAGATCGCGCAGCTCGAAGCGCTACGCGCCGA
GCTGAAGCGCATGGTCGCCGCCGGCTGCCATGGCCTCGCGGGCGATTGCCGTGTCATCGAGACGCTCGCCGACCACAGCC
TTTGCGCCCAGGAGCACGCCGCGCCGGAGCGGTTGGCGCCGGTCCAAGCATGA

Protein sequence :
MPAHTIGKLAKAADVKVPTIRFYEQIGLLPEPDRTESDRRVYGDEAVRRLAFIKHARQLGFPIEAIRTLLDLADNPDRTC
EDANALAQEQLTAVETKIAQLEALRAELKRMVAAGCHGLAGDCRVIETLADHSLCAQEHAAPERLAPVQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-21 45
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-21 45
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-20 42
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-20 42
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-20 42
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-20 42
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-20 42
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-20 42
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 7e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PHZ_c1428 YP_002130270.1 transcriptional regulator, MerR family BAC0687 Protein 2e-20 45
PHZ_c1428 YP_002130270.1 transcriptional regulator, MerR family BAC0683 Protein 2e-21 45
PHZ_c1428 YP_002130270.1 transcriptional regulator, MerR family BAC0232 Protein 2e-20 45
PHZ_c1428 YP_002130270.1 transcriptional regulator, MerR family BAC0684 Protein 2e-21 45
PHZ_c1428 YP_002130270.1 transcriptional regulator, MerR family BAC0688 Protein 2e-21 45
PHZ_c1428 YP_002130270.1 transcriptional regulator, MerR family BAC0686 Protein 2e-21 44
PHZ_c1428 YP_002130270.1 transcriptional regulator, MerR family BAC0689 Protein 2e-19 44