Gene Information

Name : MADE_1010555 (MADE_1010555)
Accession : YP_004427247.1
Strain : Alteromonas macleodii Deep ecotype
Genome accession: NC_011138
Putative virulence/resistance : Virulence
Product : AlpA family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 2357743 - 2357955 bp
Length : 213 bp
Strand : -
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence : 
ATGGAAAACTCAGTACAAACCATCAACGACCCTATTCTACGAATGTCCGATGTTGAGAAAACAGTGGGCTTAAAGAAACC
AACAATCTACAAGCTCATCAAAAAAGGTGAGTTTCCACGTCAAATCAATCTAGGCGGTAGAGCAAGCGGCTGGCTTCTTT
CAGAAATCAATCAATGGAAAGCTGAGCGTATAGCAATATCACGGGGGCAGTAA

Protein sequence : 
MENSVQTINDPILRMSDVEKTVGLKKPTIYKLIKKGEFPRQINLGGRASGWLLSEINQWKAERIAISRGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C109 AAN62202.1 phage-related protein Not tested PAGI-2(C) Protein 1e-09 50
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 8e-08 45
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 8e-08 45
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 6e-08 45
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 7e-10 44
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 2e-07 43
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 7e-08 43
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-07 43
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 3e-07 42
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 3e-07 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MADE_1010555 YP_004427247.1 AlpA family transcriptional regulator VFG0651 Protein 2e-08 45
MADE_1010555 YP_004427247.1 AlpA family transcriptional regulator VFG1480 Protein 3e-08 43