Name : MADE_1010555 (MADE_1010555) Accession : YP_004427247.1 Strain : Alteromonas macleodii Deep ecotype Genome accession: NC_011138 Putative virulence/resistance : Virulence Product : AlpA family transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 2357743 - 2357955 bp Length : 213 bp Strand : - Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+. DNA sequence : ATGGAAAACTCAGTACAAACCATCAACGACCCTATTCTACGAATGTCCGATGTTGAGAAAACAGTGGGCTTAAAGAAACC AACAATCTACAAGCTCATCAAAAAAGGTGAGTTTCCACGTCAAATCAATCTAGGCGGTAGAGCAAGCGGCTGGCTTCTTT CAGAAATCAATCAATGGAAAGCTGAGCGTATAGCAATATCACGGGGGCAGTAA Protein sequence : MENSVQTINDPILRMSDVEKTVGLKKPTIYKLIKKGEFPRQINLGGRASGWLLSEINQWKAERIAISRGQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ORF C109 | AAN62202.1 | phage-related protein | Not tested | PAGI-2(C) | Protein | 1e-09 | 50 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-08 | 45 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-08 | 45 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 6e-08 | 45 |
ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 7e-10 | 44 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 2e-07 | 43 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 7e-08 | 43 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-07 | 43 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 3e-07 | 42 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 3e-07 | 42 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
MADE_1010555 | YP_004427247.1 | AlpA family transcriptional regulator | VFG0651 | Protein | 2e-08 | 45 |
MADE_1010555 | YP_004427247.1 | AlpA family transcriptional regulator | VFG1480 | Protein | 3e-08 | 43 |