|
Name : rpmF (MADE_1008680) Accession : YP_004426872.1 Strain : Alteromonas macleodii Deep ecotype Genome accession: NC_011138 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L32 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0333 EC number : - Position : 1899818 - 1899988 bp Length : 171 bp Strand : + Note : some L32 proteins have zinc finger motifs consisting of CXXC while others do not; Derived by automated computational analysis using gene prediction method: Protein Homology. DNA sequence : ATGGCAGTACAACAAAATCGTAAAACGCGTTCTAAGCGCGGTATGCGTCGCTCACACGATGCATTGACAGGCGCGACTTT GTCTGTCGATTCAACGTCAGGCGAAACTCACCGTCGTCACCACGTGACCGCTGACGGTTATTACAAAGGCAAGAAAGTAA TCGGCGCGTAA Protein sequence : MAVQQNRKTRSKRGMRRSHDALTGATLSVDSTSGETHRRHHVTADGYYKGKKVIGA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmF | NP_814351.1 | 50S ribosomal protein L32 | Not tested | Not named | Protein | 6e-08 | 41 |
| ef0104 | AAM75307.1 | EF0104 | Not tested | Not named | Protein | 4e-08 | 41 |
