Gene Information

Name : MADE_1005560 (MADE_1005560)
Accession : YP_004426252.1
Strain : Alteromonas macleodii Deep ecotype
Genome accession: NC_011138
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1123719 - 1124105 bp
Length : 387 bp
Strand : +
Note : Derived by automated computational analysis using gene prediction method: GeneMarkS+.

DNA sequence :
ATGACACGAAGTATCAGCAAAGTTGCCAAAGAGCTCGATATAAACGTTGAAACAGTTCGATTTTATGAGCGTAGAGGCTT
AATTCTGCAACCGACTAAACCCGAAGTGGGATACCGCCACTATCCCGATGACACAGTGAGTCGAATTCGCTTTATCAAAC
GCGCACAAGTGCTTGGATTTACGCTAGATGAAATTGCCAACCTCTTGAGTTTGAATGATCACCCATGTGGACAGGTTCAA
GAGCTTGCAGAATATAAGTTGAGCACCGTCAAAGAAAAGATGGCAGACCTGAAACGGTTAGAAAGTGCGCTAATGGAGTT
ATTAACACAATGTAATAGCAATGACGATGATAGTTATTGTCCTATTATCGACTCCCTACAACCCTAG

Protein sequence :
MTRSISKVAKELDINVETVRFYERRGLILQPTKPEVGYRHYPDDTVSRIRFIKRAQVLGFTLDEIANLLSLNDHPCGQVQ
ELAEYKLSTVKEKMADLKRLESALMELLTQCNSNDDDSYCPIIDSLQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 4e-28 50
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-28 50
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-27 49
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-27 49
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-27 49
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-27 49
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-27 49
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-27 49
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-27 48
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 4e-30 46
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 9e-26 44
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 1e-19 41
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 1e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MADE_1005560 YP_004426252.1 MerR family transcriptional regulator BAC0688 Protein 6e-29 51
MADE_1005560 YP_004426252.1 MerR family transcriptional regulator BAC0232 Protein 3e-29 50
MADE_1005560 YP_004426252.1 MerR family transcriptional regulator BAC0687 Protein 3e-29 50
MADE_1005560 YP_004426252.1 MerR family transcriptional regulator BAC0684 Protein 1e-28 50
MADE_1005560 YP_004426252.1 MerR family transcriptional regulator BAC0683 Protein 3e-28 49
MADE_1005560 YP_004426252.1 MerR family transcriptional regulator BAC0686 Protein 2e-28 49
MADE_1005560 YP_004426252.1 MerR family transcriptional regulator BAC0689 Protein 2e-27 49
MADE_1005560 YP_004426252.1 MerR family transcriptional regulator BAC0682 Protein 4e-22 43