Gene Information

Name : HY04AAS1_1151 (HY04AAS1_1151)
Accession : YP_002121815.1
Strain : Hydrogenobaculum sp. Y04AAS1
Genome accession: NC_011126
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1063203 - 1063880 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: lsp:Bsph_2783 response regulator ArlR

DNA sequence :
ATGAGCCTTAAAGCTCTTATAGTAGAAGATGATGAGCTTTTACTAGAAACGTTAGAAAAGGGGTTTAGACACGAAGGATT
TGAAGTAGATATAGCAAAAGACGGCTTTCAGGCTCTTCAAAAGGCAAAAACAAACAGCTACGATATCATAATTCTCGATG
TTGTAATTCCCAAAATAGACGGTGTAAAAGTATGTAAACAGTTAAGACTTCAAAGTGAAATCCCCATTATTATGCTAACG
GCAAAATCTCAGCTAGAGGATAAGCTAGAGGGCCTTGAAGCAGGAGCAGACGATTACATCACAAAGCCCTTTTCTTTTAA
AGAACTCATAATGAGGGTAAAAACCGTTTTAAGACGTTATAACAAAGTGCAAGAAGAAAAGATAGTTTTAAAAGACCTCA
CAATGGATTTAAAAGATTTTAAGGTATTTTATAAAGGAAAAGCTATAAACCTTACACCAAAAGAGTTTGAGCTTTTAAAA
GTTTTAGCTCAAAACCCAAACAAAACCATAAGAAGAGAAGTGCTTTTAAACAAAGTATGGGGCATAGCCTCCGATTACGA
TTCAAACATCGTAGATGTCTATATAAAAAATATCCGTAACAAACTAGAAGATAAACCCCCAAAGCTTATCCTCACCATAA
GAGGAAGAGGTTATATGTTAAGCACAGAGCAAAGTTGA

Protein sequence :
MSLKALIVEDDELLLETLEKGFRHEGFEVDIAKDGFQALQKAKTNSYDIIILDVVIPKIDGVKVCKQLRLQSEIPIIMLT
AKSQLEDKLEGLEAGADDYITKPFSFKELIMRVKTVLRRYNKVQEEKIVLKDLTMDLKDFKVFYKGKAINLTPKEFELLK
VLAQNPNKTIRREVLLNKVWGIASDYDSNIVDVYIKNIRNKLEDKPPKLILTIRGRGYMLSTEQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-34 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-39 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-39 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-39 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-39 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-39 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-39 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-39 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-39 46
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-33 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-34 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-34 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-34 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-34 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-34 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-33 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-34 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-34 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-34 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-32 45
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-28 44
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-34 43
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-28 42
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-30 42
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator BAC0125 Protein 8e-37 41
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-34 41
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-32 41
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-34 41
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator VFG0596 Protein 9e-34 42
HY04AAS1_1151 YP_002121815.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-36 42