Name : SeSA_A0668 (SeSA_A0668) Accession : YP_002113634.1 Strain : Salmonella enterica CVM19633 Genome accession: NC_011094 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 652744 - 652941 bp Length : 198 bp Strand : + Note : identified by match to protein family HMM PF05930 DNA sequence : ATGTCGCAATCATTCATTCGTCTTTCTGAAGTCCAGCGCCGTACTGGTTACAGTAAAGCTTGGATCTACCGCTTGATTGG ACAGGGTAAATTCCCTTCCTCTGTCAAAATTGGCTCTCGCGCCATTGCTTTCGTCGAAAGTGAAGTTGATGACTGGATTA ACCAGCGCATCGAAGAGTCGCGTAAGGAGGTTGCCTGA Protein sequence : MSQSFIRLSEVQRRTGYSKAWIYRLIGQGKFPSSVKIGSRAIAFVESEVDDWINQRIEESRKEVA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-07 | 52 |
VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-07 | 52 |
VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 8e-08 | 52 |
VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 6e-09 | 46 |
VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 46 |
VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 46 |
VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-06 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
SeSA_A0668 | YP_002113634.1 | hypothetical protein | VFG1118 | Protein | 3e-08 | 52 |
SeSA_A0668 | YP_002113634.1 | hypothetical protein | VFG1141 | Protein | 1e-09 | 46 |