Name : rpmG (Ppha_1649) Accession : YP_002018503.1 Strain : Pelodictyon phaeoclathratiforme BU-1 Genome accession: NC_011060 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : - COG ID : - EC number : - Position : 1739894 - 1740076 bp Length : 183 bp Strand : + Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGGCAAAAGGAAAAGAAAACAGAATCGTTATCACCCTTGAATGTACCGAAGCAAAAAAAGAGGGAAAAACGGTCTCAAG ATATACCACAACAAAAAACAAGAAAAATACCACAGAACGTCTTATCTTGAAGAAGTATAACCCCAATATGCAGCGTCATA CCCTGCACAAGGAGATCAAATAA Protein sequence : MAKGKENRIVITLECTEAKKEGKTVSRYTTTKNKKNTTERLILKKYNPNMQRHTLHKEIK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 0.11 | 46 |
ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 0.078 | 46 |