|
Name : rpmG (Cpar_0786) Accession : YP_001998402.1 Strain : Chlorobaculum parvum NCIB 8327 Genome accession: NC_011027 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : - COG ID : - EC number : - Position : 850367 - 850549 bp Length : 183 bp Strand : - Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGGCAAAAGGAAAAGAGAACAGGATCATTGTGACGCTTGAGTGCACCGAAGCTAAAAAGGAAGGCAAACCGGTCTCAAG ATACACCACGACCAAGAACAAAAAGAACACCACGGAGCGACTCATACTCAAGAAGTACAATCCGAATCTCAAGAGGCACA CCGAGCACAAAGAGATCAAGTAA Protein sequence : MAKGKENRIIVTLECTEAKKEGKPVSRYTTTKNKKNTTERLILKKYNPNLKRHTEHKEIK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 0.15 | 46 |
| ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 0.10 | 46 |
