Gene Information

Name : Rpal_4072 (Rpal_4072)
Accession : YP_001993043.1
Strain : Rhodopseudomonas palustris TIE-1
Genome accession: NC_011004
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 4374374 - 4374799 bp
Length : 426 bp
Strand : -
Note : TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related; KEGG: oan:Oant_3199 arsenate reductase

DNA sequence :
ATGGACGTCGTCATCTATCACAACCCCGCCTGCGGCACCTCGCGCAACACGCTCGGCCTGATCCGCAACGCTGGGATCGA
GCCGCACGTGATCGAGTATCTGAAGTGCCCGCCGACCAGGGCGCTGCTGAAACAACTGATCGCCCGCGCCGGGCTCACGC
CGCGGCAGGCGCTGCGCGAAAAGGGCACGCCTTATGCGGAGCTGAAGCTCGACGACCTGGCGCTCAGCGACGACGATCTG
CTCGACGCGATGATCGCGCATCCGATCCTGATCCAGCGGCCTTTGGTGGTGACGCCGAACGGCGTGCGGATCTGCCGGCC
GTCCGAAGCCGTGCTCGACCTGCTACCGCCGCAGCGCGGCGAGTTCGTCAAGGAAGACGGCGAATTGGTGATCGACGCCA
GTGGGCGCAGGGTCGCGACGGCGTGA

Protein sequence :
MDVVIYHNPACGTSRNTLGLIRNAGIEPHVIEYLKCPPTRALLKQLIARAGLTPRQALREKGTPYAELKLDDLALSDDDL
LDAMIAHPILIQRPLVVTPNGVRICRPSEAVLDLLPPQRGEFVKEDGELVIDASGRRVATA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 3e-31 60
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 3e-31 60
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 4e-31 60
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 2e-29 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpal_4072 YP_001993043.1 arsenate reductase BAC0584 Protein 3e-31 58
Rpal_4072 YP_001993043.1 arsenate reductase BAC0583 Protein 1e-30 58
Rpal_4072 YP_001993043.1 arsenate reductase BAC0585 Protein 2e-30 58
Rpal_4072 YP_001993043.1 arsenate reductase BAC0582 Protein 3e-30 56