Gene Information

Name : Rpal_2126 (Rpal_2126)
Accession : YP_001991123.1
Strain : Rhodopseudomonas palustris TIE-1
Genome accession: NC_011004
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2294702 - 2295376 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: nha:Nham_1433 two component transcriptional regulator, winged helix family

DNA sequence : 
GTGCGTCTGCTCGTCGTCGAAGATGACCCCGATCTCAACCGCCAGCTCACCACCGCGCTGACCGATGCCGGTTACGTGGT
CGACCGCGCCTTCGATGGCGAGGAGGGGCATTTCCTCGGCGACACCGAGCCGTACGACGCCGTCGTGCTCGACATCGGCC
TGCCGAAGATGGATGGCATCTCGGTGCTGGAGGCGTGGCGGCGAAACAGCCGCGCGATGCCGGTGCTGATCCTCACCGCG
CGCGACCGCTGGAGCGACAAGGTGCAGGGCTTCGACGCCGGCGCCGATGATTACGTCGCCAAGCCATTCCATCTCGAGGA
AGTGCTGGCGCGGATCCGCGCGCTGCTGCGGCGGAGTGCCGGCCATGCGCAATCCGAGCTGACCTGCGGCCCGGTGGTGC
TCGACACCCGCACCGGCCGGGTCAGCGTCAGCGGCAATCCGGTGAAGCTGACCAGCCACGAATATCGTCTGCTGGCCTAT
CTGATGCACCACTCCGGCCGGGTGGTGTCGCGCACCGAGCTGGTCGAGCATCTGTACGATCAGGATTTCGACCGCGACAG
CAACACCATCGAGGTGTTCGTCGGCCGCATCCGCAAGAAGCTCGGCGTCGACATCATCCAGACCGTGCGCGGGCTCGGCT
ATCTGCTGTCGCCGCCGGCCGCGGACGCGCATTAG

Protein sequence : 
MRLLVVEDDPDLNRQLTTALTDAGYVVDRAFDGEEGHFLGDTEPYDAVVLDIGLPKMDGISVLEAWRRNSRAMPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHLEEVLARIRALLRRSAGHAQSELTCGPVVLDTRTGRVSVSGNPVKLTSHEYRLLAY
LMHHSGRVVSRTELVEHLYDQDFDRDSNTIEVFVGRIRKKLGVDIIQTVRGLGYLLSPPAADAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 5e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-41 49
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 5e-36 46
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator BAC0530 Protein 4e-36 46
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 1e-35 45
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 4e-38 45
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 4e-35 44
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 9e-35 44
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 1e-35 44
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator BAC0487 Protein 3e-30 44
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator BAC0347 Protein 7e-27 41
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-31 41
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator VFG0475 Protein 1e-35 45
Rpal_2126 YP_001991123.1 winged helix family two component transcriptional regulator VFG0473 Protein 3e-28 41