Gene Information

Name : Rpal_1111 (Rpal_1111)
Accession : YP_001990131.1
Strain : Rhodopseudomonas palustris TIE-1
Genome accession: NC_011004
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1178947 - 1179303 bp
Length : 357 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: azc:AZC_1284 transposase

DNA sequence :
GTGATCGGTCCGACGGGCGCGGTGCGGGTGATGGTGGCGACCAGGCCCGTCGACTTCCGCAAGGGTGCCGAAGGGCTCGC
CGCCCTGGTGCGCGAGAGCATGCAGGCCGATCCGTTCTCCGGCGCGGTGTATGTGTTCCGCGCCAAGCGAGCCGACCGGG
TGAAGCTGATCTACTGGGACGGCACCGGCGTGTGCCTGTTCGCCAAGCGGCTGGAGACCGGTTCGTTCTGCTGGCCGAAC
GTGCAGGACGGCGTCATTCGCCTGACCGCGGCGCAGTTGTCAGCGCTGCTCGAAGGGCTGGACTGGAAGCGCGTCCACGC
TGCGCGCGAGACACCGTCGCCGATCCAGGCGAACTGA

Protein sequence :
MIGPTGAVRVMVATRPVDFRKGAEGLAALVRESMQADPFSGAVYVFRAKRADRVKLIYWDGTGVCLFAKRLETGSFCWPN
VQDGVIRLTAAQLSALLEGLDWKRVHAARETPSPIQAN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-21 50
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-21 44
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-21 44
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-18 44
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-18 44
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-18 44
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-19 44
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-17 44
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-18 44
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-19 44
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-17 44
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-18 44
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-18 44
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-18 44
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-18 44
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-21 43
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-18 42
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-18 42
unnamed ABR13518.1 transposase Not tested PAGI-7 Protein 5e-10 42
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-18 42
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 8e-10 42
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-12 41
RL060 AAP84185.1 transposase Not tested PAPI-1 Protein 2e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpal_1111 YP_001990131.1 IS66 Orf2 family protein VFG0792 Protein 4e-19 44
Rpal_1111 YP_001990131.1 IS66 Orf2 family protein VFG1698 Protein 3e-19 44
Rpal_1111 YP_001990131.1 IS66 Orf2 family protein VFG1709 Protein 4e-19 44
Rpal_1111 YP_001990131.1 IS66 Orf2 family protein VFG1665 Protein 2e-21 43
Rpal_1111 YP_001990131.1 IS66 Orf2 family protein VFG1052 Protein 1e-18 42
Rpal_1111 YP_001990131.1 IS66 Orf2 family protein VFG1517 Protein 7e-13 41