Gene Information

Name : BCAM0714 (BCAM0714)
Accession : YP_002233337.1
Strain :
Genome accession: NC_011001
Putative virulence/resistance : Virulence
Product : two-component regulatory system response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 792436 - 793119 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATTCTGATTGTCGAGGATGAACCGAAGACGGGCGCGTATCTGCGCAAGGGCCTGACCGAGGCCGGCTACGTCGT
CGACTGGGTCGAGGACGGCATCACGGGCCAGCACCAGGCCGAAACGGAGGAGTACGACCTGCTCGTGCTCGACGTGATGC
TGCCCGGGCAGGACGGCTGGACGCTGCTGCAGAACCTGCGGCGCAGCAAGTCGACGCCCGTGCTGTTCCTCACCGCGCGC
GACGACGTCGGCGATCGCGTGAAGGGGCTCGAACTTGGCGCGGACGACTATCTCGCGAAGCCGTTCGACTTCGTCGAGCT
GACCGCACGCATCAAGTCGATCCTGCGGCGCGGCCAGCCGCGCGACTCGAACACGCTGCGCGTGGCCGATCTCGAACTCG
ACCTGACGCGCCGCAAGGCCACGCGGCAGGGCGATACGATCCTGCTGACCGCGAAGGAATTCGCGCTGCTGTGGCTGCTG
ATGCGCCGCGAAGGCGAGATCCTGCCGCGCGCGACGATCGCGTCGCAGGTGTGGGACATGAATTTCAACAGCGACACGAA
CGTCGTCGATTCGGCGATCCGCCGGCTGCGCTCGAAGATCGACGACGCGTACGAACCGAAGCTGATCCACACGGTGCGCG
GCATGGGCTACGTGCTCGAAGCGCGCGGCGGCGCGGCCGCATGA

Protein sequence :
MRILIVEDEPKTGAYLRKGLTEAGYVVDWVEDGITGQHQAETEEYDLLVLDVMLPGQDGWTLLQNLRRSKSTPVLFLTAR
DDVGDRVKGLELGADDYLAKPFDFVELTARIKSILRRGQPRDSNTLRVADLELDLTRRKATRQGDTILLTAKEFALLWLL
MRREGEILPRATIASQVWDMNFNSDTNVVDSAIRRLRSKIDDAYEPKLIHTVRGMGYVLEARGGAAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-58 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-57 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein BAC0197 Protein 1e-94 86
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein BAC0083 Protein 2e-66 62
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein BAC0125 Protein 2e-68 62
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein BAC0638 Protein 6e-60 61
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein BAC0308 Protein 5e-63 60
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein BAC0111 Protein 5e-64 58
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein BAC0347 Protein 2e-59 55
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_010079.5776364.p0 Protein 1e-35 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_002952.2859858.p0 Protein 1e-35 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_007622.3794948.p0 Protein 1e-35 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_003923.1003417.p0 Protein 1e-35 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_013450.8614146.p0 Protein 1e-35 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_002951.3238224.p0 Protein 1e-35 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_007793.3914065.p0 Protein 1e-35 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_002758.1121390.p0 Protein 1e-35 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein AE015929.1.gene1106. Protein 3e-30 42
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_002952.2859905.p0 Protein 3e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_009641.5332272.p0 Protein 2e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_013450.8614421.p0 Protein 2e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_007793.3914279.p0 Protein 2e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_003923.1003749.p0 Protein 3e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_002745.1124361.p0 Protein 2e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_009782.5559369.p0 Protein 2e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_002951.3237708.p0 Protein 2e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_007622.3794472.p0 Protein 3e-33 41
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein NC_002758.1121668.p0 Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein VFG0596 Protein 9e-59 56
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein VFG1390 Protein 6e-38 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein VFG1389 Protein 1e-31 43
BCAM0714 YP_002233337.1 two-component regulatory system response regulator protein VFG0473 Protein 9e-34 41