Gene Information

Name : BCAM0247 (BCAM0247)
Accession : YP_002232879.1
Strain :
Genome accession: NC_011001
Putative virulence/resistance : Unknown
Product : putative transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 303492 - 303839 bp
Length : 348 bp
Strand : +
Note : -

DNA sequence :
ATGATCGGTCTGCCTCAAAACACGCGGATCTGGATCGCGGCGGGCGTCACCGATATGCGATGCGGCTTCAATTCGTTGGC
CGCGAAGGTACAGACGGTGCTGGAGAAAGATCCGTTCTCTGGACACGTGTTCGTGTTCCGGGGCAAGCGCGGTGACCTGC
TGAAGTGCTTGTATTGGAGCGACGGCGGGCTATGTTTATTGGCGAAGCGGCTCGAAAAAGGACGCTTTGCTTGGCCCCGT
GCCGACTCTGGTGTGGTCGCGCTGACAACCGCGCAGCTGTCGTTGTTGCTCGAGGGCTTCGATTGGCGACAGCCGGTCGA
AGCCGTGCGTCCACGTAGCGCGCTGTAA

Protein sequence :
MIGLPQNTRIWIAAGVTDMRCGFNSLAAKVQTVLEKDPFSGHVFVFRGKRGDLLKCLYWSDGGLCLLAKRLEKGRFAWPR
ADSGVVALTTAQLSLLLEGFDWRQPVEAVRPRSAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-49 100
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-29 68
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-29 68
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-29 68
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-29 68
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-29 68
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-28 68
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-28 68
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-29 68
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-29 68
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-29 68
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-29 68
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-29 68
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 5e-22 67
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-29 67
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-31 63
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-31 63
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-30 61
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 9e-31 61
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 9e-31 61
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-28 59
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-28 59
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-26 58
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-26 58
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-28 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase VFG1698 Protein 5e-30 68
BCAM0247 YP_002232879.1 putative transposase VFG1709 Protein 7e-30 68
BCAM0247 YP_002232879.1 putative transposase VFG0792 Protein 7e-30 68
BCAM0247 YP_002232879.1 putative transposase VFG1517 Protein 2e-22 67
BCAM0247 YP_002232879.1 putative transposase VFG1052 Protein 2e-29 67
BCAM0247 YP_002232879.1 putative transposase VFG1665 Protein 4e-31 61
BCAM0247 YP_002232879.1 putative transposase VFG1737 Protein 1e-28 57