Gene Information

Name : BCAM1013a (BCAM1013a)
Accession : YP_002233631.1
Strain :
Genome accession: NC_011001
Putative virulence/resistance : Resistance
Product : aminoglycoside resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1126467 - 1127258 bp
Length : 792 bp
Strand : +
Note : streptomycin 3'-adenyltransferase

DNA sequence :
GTGACGGACGACACCCCGCACGACATCGCCGCACAGGTCGCCGCCGCACGTGTCGTGATCGAACGGCATCTCGGCGCGAC
GCTGGAAGCGATCCACCTGTTCGGATCGGTGCTCGACGGCGGCCTGAAACCGCGCAGCGACATCGATTTGCTGGTGACGG
TGGCGGTGCGCCCGGACGAAGCGGCGCGACACGCGCTGATGTCGGACCTGCTCGGTGCTTCTGCGCCGCCCGGTTGCAGC
GGCGGCATGCGTGCGCTGGAGGTCACGGTCGTCGCGCACGGCGACGTGGTGCCGTGGCGTCATCCGGCGCGACGCGAGCT
GCAGTTCGGCGAATGGCTGCGCAGCGACCTCGACGCCGGCATCGTCGAGCCGCCGCTCGTCGATCACGATCTGGCCATCC
TGCTGACGAAGGCGCGCGAGCACAGCATCGCGCTGGTCGGCCCGCCCGCGGACGTGCTGTTCGAGCCGGTGCCCGCGCGC
GACTTCGTCGCCGCGCTGCTCGCTACCGTGGCGCAGTGGCAGGCGGAACCCGACTGGCGCGACGACGCGTGCAACATCGT
GCTCGCGCTCGCGCGCATCTGGTATAGCGCCGCGACCGGCAAAATCGCGCCGAAGGACGTCGCCGCGGCGTGGGTGCTGG
CGCGCCTGCCGGACGCGCACCGGCCGGTTCTGGCGGCTGCGCGTGCGGCCTATCTCGATGGTGACGCAGGCGCGGCGATC
CTGTCGGGCGAACCGCTGGCGGAATTCATCGGCTACGCGCGGCGGACGATCGAGTCGATGCTGTCGGCGTAG

Protein sequence :
MTDDTPHDIAAQVAAARVVIERHLGATLEAIHLFGSVLDGGLKPRSDIDLLVTVAVRPDEAARHALMSDLLGASAPPGCS
GGMRALEVTVVAHGDVVPWRHPARRELQFGEWLRSDLDAGIVEPPLVDHDLAILLTKAREHSIALVGPPADVLFEPVPAR
DFVAALLATVAQWQAEPDWRDDACNIVLALARIWYSAATGKIAPKDVAAAWVLARLPDAHRPVLAAARAAYLDGDAGAAI
LSGEPLAEFIGYARRTIESMLSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aadA7 AGF35062.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-61 60
aadA7 AGK06932.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-61 60
aadA7 AGK06969.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-61 60
aadA7 AGK07015.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-61 60
aadA7 AGK07073.1 aminoglycoside adenyltransferase Not tested SGI1 Protein 5e-61 60
aadA7 AAR21854.1 aminoglycoside (3'')(9) adenylyltransferase; AAD(3'')(9) Not tested SGI1 Protein 5e-61 60
aadA7 AAT37846.1 aminoglycoside adenyltransferase Not tested Class I integron Protein 5e-61 60
aadA2 AAK02046.1 streptomycin/spectinomycin resistance protein Not tested SGI1 Protein 2e-62 59
aadA2 AGF35027.1 AadA2 aminoglycoside adenylyltransferase Not tested SGI1 Protein 2e-62 59
aadA1 CAJ77048.1 Aminoglycoside adenylyltransferase Not tested AbaR1 Protein 3e-64 59
aadA2 ACF06158.1 aminoglycoside 3''-adenyltransferase Not tested Tn5036-like Protein 1e-62 57
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Not tested ICEPmu1 Protein 2e-63 56
aadA1 ACY75515.1 aminoglycoside adenyltransferase Not tested Tn6060 Protein 7e-64 55
aadA1 YP_005797133.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 5e-64 55
aadA1 CAD92142.1 aminoglycoside adenyltransferase Not tested Not named Protein 7e-64 55
aadA1 YP_005797149.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 5e-64 55
aadDA1 CAJ77087.1 Aminoglycoside 3-adenylyltransferase Not tested AbaR1 Protein 4e-64 55
aadA1 YP_006098376.1 aminoglycoside adenylyltransferase Not tested Tn2411 Protein 5e-64 55
aadA1 ACV89835.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR7 Protein 4e-64 55
aadA1 ACN81025.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR5 Protein 5e-64 55
unnamed AFV53113.1 AadA1 aminoglycoside (3') adenyltransferase Not tested AbGRI2-1 Protein 4e-64 55
aadA1 AGK36646.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR26 Protein 4e-64 55
aadA1 AAL08435.1 streptomycin adenyltransferase AadA1 Not tested SRL Protein 2e-59 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAM1013a YP_002233631.1 aminoglycoside resistance protein DQ865198.gene.p01 Protein 1e-66 64
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AY139598.1.gene2.p01 Protein 4e-66 64
BCAM1013a YP_002233631.1 aminoglycoside resistance protein NC_010558.1.6275994. Protein 1e-66 64
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AY263741.gene.p01 Protein 5e-61 64
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AJ628353.gene.p01 Protein 1e-54 60
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AM932669.1.gene3.p01 Protein 3e-64 59
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AF047479.2.orf1.gene Protein 2e-63 59
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AF174129.3.gene3.p01 Protein 4e-62 59
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AF294653.1.gene3.p01 Protein 1e-62 59
BCAM1013a YP_002233631.1 aminoglycoside resistance protein EU118119.1.orf1.gene Protein 2e-62 59
BCAM1013a YP_002233631.1 aminoglycoside resistance protein NC_010410.6003170.p0 Protein 2e-64 59
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AJ704863.gene12.p01 Protein 6e-61 58
BCAM1013a YP_002233631.1 aminoglycoside resistance protein U37105.2.gene4.p01 Protein 5e-62 57
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AJ584652.2.gene7.p01 Protein 2e-63 56
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AY339625.2.gene17.p0 Protein 2e-64 55
BCAM1013a YP_002233631.1 aminoglycoside resistance protein Y18050.2.gene6.p01 Protein 5e-64 55
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AY123251.gene3.p01 Protein 2e-64 55
BCAM1013a YP_002233631.1 aminoglycoside resistance protein NC_010410.6003168.p0 Protein 2e-64 55
BCAM1013a YP_002233631.1 aminoglycoside resistance protein JN596991.2.gene3.p01 Protein 5e-64 55
BCAM1013a YP_002233631.1 aminoglycoside resistance protein FR748153.1.gene5.p01 Protein 5e-64 55
BCAM1013a YP_002233631.1 aminoglycoside resistance protein AF313471.1.gene3.p01 Protein 2e-64 55
BCAM1013a YP_002233631.1 aminoglycoside resistance protein NC_003198.gene.p01 Protein 4e-43 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAM1013a YP_002233631.1 aminoglycoside resistance protein VFG1026 Protein 1e-59 55