Gene Information

Name : BCAL0054 (BCAL0054)
Accession : YP_002229218.1
Strain :
Genome accession: NC_011000
Putative virulence/resistance : Resistance
Product : MerR family regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 64991 - 65422 bp
Length : 432 bp
Strand : -
Note : -

DNA sequence : 
ATGAAGATTGGCGAACTGGCCAAAGCGGCCCGCTGCACGCCCGAGACGATCCGTTTCTACGAGAAAGAGGGTCTAATGCC
GGACGCGGAGCGCACCGATTCGAACTACCGCAACTACACCGACGTGCACGTCGAACGGCTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGGCGCACGACGAGATCCGCGCACTGCTGCGGCTCACCGACACGCCGGCCGACCGCTGCGATTCGATC
AATTCGCTGCTCGACGATCACATCGGACACGTCGATGCGCGCCTCGCGGAACTCACGCAGTTGCGCGACCAGCTCACCGA
ACTGCGGCGCCAGTGCGTCGGCGAGCATTCGGTCGAGGATTGCGGGATCGTGCATGGCCTCGCGACGATGGAAACCGTCG
CGCCGGCCGCGAAGCGCTCGCACCTCGGCTGA

Protein sequence : 
MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRNYTDVHVERLRFIRNCRALDMAHDEIRALLRLTDTPADRCDSI
NSLLDDHIGHVDARLAELTQLRDQLTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRSHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-31 49
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 4e-30 47
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-30 47
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-30 47
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-30 47
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 6e-30 46
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 8e-30 46
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 5e-30 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAL0054 YP_002229218.1 MerR family regulatory protein BAC0058 Protein 1e-39 56
BCAL0054 YP_002229218.1 MerR family regulatory protein BAC0301 Protein 1e-31 53