Gene Information

Name : BCAL2961 (BCAL2961)
Accession : YP_002232061.1
Strain :
Genome accession: NC_011000
Putative virulence/resistance : Unknown
Product : putative integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 3241751 - 3242995 bp
Length : 1245 bp
Strand : +
Note : -

DNA sequence :
ATGCCACTGACCGACACGACCATCCGCAACACGAAGCCGGCCGAGAAGCCCGTGAAGCTGTTCGACGGCGGTGGCCTGTT
TCTGTTGGTCACGCCGGCCGGACAGCGCTATTGGCGACTCAAGTACCGCGCTGCCGGTAAAGAGAAACTTCTGGCGCTCG
GCGTCTATCCTGACGTGACGCTAGCGGCGGCGCGCCGTAAGCGCGACGAGGCCCGGGAAAAGCTGGCCGCTGGCATCGAT
CCAGGCGAGGCAAAAAAGGCCGAAAAGCGTACGGCCAGGCTGAGTGCCGAAAATTCGTTCGAGGCTGTCGCGCGCGAGTG
GCATATCAAGTATGCGCCCACCTGGTCGGAAAGCCACGGCTCGCGAATCCTGCGCCGCCTAGAGGTAGACGCCTTTCCGT
GGATTGGCAGCAAGCCCATTGCTGAGCTCGCCCCACCAGACGTGCTCGAAGTGCTGCGCCGGGTGGAAAAGCGCGGCGCA
CTCGAGACGGCGCATCGCCTGCACGCGAACGTCAGCCAGGTGTGTCGCTATGCTGTCGCGACCGGCCGCGCCCAACGAGA
CGTGACGGCCGATCTCCGCGGAGCCCTTCCGCCAGTGCAACAAGAACACATGGCAGCGGTCACCGACCCGAAACAGGTCG
CCGAGCTGCTGCGCTCCATAGACGGCTATCAGGGCACATTCCCCGTGCTGTGCGCGTTGCGCCTCTTCCCACTGCTCTTC
CAGCGTCCCGGTGAGCTGCGCGCCGCCGAGTGGTCCGAGTTCGACCTAGACGCAAGCACGTGGGAAATTCCGAGCGAGCG
GATGAAGCGCACCAAGCAAGGCAAAGCGTCCGGCGGCGCGCACATCGTCCCACTGTCGGCACAAGCGGTCGCTATCCTGC
GCGATCTGCACGCCTTGACGGGCAACAGCCGGTTCCTGTTTCCGAGTGTGCGGACGAAGGACCGCCCCATGTCCGACAAC
ACCATCAACGGTGCGCTGCGCCGGCTCGGCTACGATGGCGACACGATGACCGGTCACGGCTTCAGGGCGATGGCTCGAAC
GATTCTCGATGAAGTGCTCGGCGTGCCGGTTGCGATTGTGGAGGCACAACTGGCGCACGCCGTGAAGGATCCACTCGGCC
GTGCGTATAACCGCACCGCTCACCTGCCCCAGCGCCGCGAGATGATGCAGCGCTGGGCCGACTACCTCGACCAGCTCAAG
GCAGGTGCCGAAATCATCCCCATCACGGCCGCGATGGGCAAATGA

Protein sequence :
MPLTDTTIRNTKPAEKPVKLFDGGGLFLLVTPAGQRYWRLKYRAAGKEKLLALGVYPDVTLAAARRKRDEAREKLAAGID
PGEAKKAEKRTARLSAENSFEAVAREWHIKYAPTWSESHGSRILRRLEVDAFPWIGSKPIAELAPPDVLEVLRRVEKRGA
LETAHRLHANVSQVCRYAVATGRAQRDVTADLRGALPPVQQEHMAAVTDPKQVAELLRSIDGYQGTFPVLCALRLFPLLF
QRPGELRAAEWSEFDLDASTWEIPSERMKRTKQGKASGGAHIVPLSAQAVAILRDLHALTGNSRFLFPSVRTKDRPMSDN
TINGALRRLGYDGDTMTGHGFRAMARTILDEVLGVPVAIVEAQLAHAVKDPLGRAYNRTAHLPQRREMMQRWADYLDQLK
AGAEIIPITAAMGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 2e-66 45
int CAC39282.1 integrase Not tested LPA Protein 1e-70 45
int AAD44730.1 Int Not tested SHI-2 Protein 2e-70 45
aec33 AAW51716.1 Int Not tested AGI-3 Protein 5e-71 45
int AAC31482.1 CP4-like integrase Not tested LEE Protein 2e-70 45
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 3e-70 45
int ACU09430.1 integrase Not tested LEE Protein 2e-70 45
ECs4534 NP_312561.1 integrase Not tested LEE Protein 3e-70 45
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 3e-72 45
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 1e-70 45
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 9e-71 45
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 1e-70 45
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 8e-71 45
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 8e-71 45
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 2e-69 45
int AAL51003.1 CP4-like integrase Not tested LEE Protein 5e-70 45
int AAK16198.1 Int Not tested PAI-I AL862 Protein 7e-71 45
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 7e-71 45
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 6e-71 45
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 2e-70 45
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 9e-72 45
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 9e-72 45
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 2e-68 44
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 1e-68 44
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 2e-68 44
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 4e-70 44
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 7e-70 44
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 1e-69 44
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 1e-70 44
int AAL51028.1 CP4-like integrase Not tested LEE Protein 1e-70 44
int AAK00456.1 Int Not tested SHI-1 Protein 2e-63 44
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 2e-70 44
int-phe AAL60261.1 Int-phe Not tested LEE Protein 1e-70 44
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 2e-70 44
int CAC81896.1 integrase Not tested LEE II Protein 8e-63 44
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 6e-60 42
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 7e-61 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAL2961 YP_002232061.1 putative integrase VFG0783 Protein 1e-70 45
BCAL2961 YP_002232061.1 putative integrase VFG0626 Protein 3e-71 45
BCAL2961 YP_002232061.1 putative integrase VFG1693 Protein 9e-71 45
BCAL2961 YP_002232061.1 putative integrase VFG0598 Protein 7e-69 44
BCAL2961 YP_002232061.1 putative integrase VFG1536 Protein 3e-60 42