Gene Information

Name : BCAL2831 (BCAL2831)
Accession : YP_002231933.1
Strain :
Genome accession: NC_011000
Putative virulence/resistance : Virulence
Product : two-component regulatory system, response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3109477 - 3110139 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence :
ATGCGGATTCTGCTTGTCGAAGATGATCGAATGATTGCCGAGGGCGTGCGCAAGGCGCTGCGCTCGGACGGCTTTGCGGT
CGACTGGGTGCAGGACGGCGACGCCGCGCTGACGGCGCTCGGCGGCGAGACGTACGATCTGCTGCTGCTCGATCTCGGCC
TGCCGAAGCGCGACGGCATCGACGTGCTGCGCACGCTGCGCGGGCGCGGGCTCGCGCTGCCGGTGCTGATCGTCACCGCG
CGCGACGCCGTCGCCGATCGCGTGAAGGGGCTCGACGCGGGCGCCGACGATTACCTCGTCAAGCCGTTCGATCTCGACGA
GCTGGGCGCACGGATGCGCGCGCTGATCCGCCGTCAAGCGGGGCGCAGCGAGTCGCTGATCCGCCACGGCGCGCTGACGC
TCGATCCCGCGTCGCACCAGGTGACGCTCGACGGCGCGCCCGTTGCGCTGTCCGCGCGCGAGTTCGCGCTGCTCGAGGCG
CTGCTCGCGCGGCCGGGCGCGGTGCTGTCGAAGAGCCAGCTCGAGGAGAAGATGTACGGCTGGGGCGAGGAGATCGGCAG
CAACACGGTCGAGGTCTACATCCACGCGCTGCGCAAGAAGCTCGGTTCGGACCTGATCCGCAACGTGCGCGGGCTCGGCT
ACATGGTCGTCAAGGAAAGCTGA

Protein sequence :
MRILLVEDDRMIAEGVRKALRSDGFAVDWVQDGDAALTALGGETYDLLLLDLGLPKRDGIDVLRTLRGRGLALPVLIVTA
RDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQAGRSESLIRHGALTLDPASHQVTLDGAPVALSAREFALLEA
LLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-32 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-20 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein BAC0487 Protein 1e-28 48
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein BAC0197 Protein 9e-25 45
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein BAC0083 Protein 5e-22 44
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein NC_002516.2.879194.p Protein 3e-22 43
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein BAC0638 Protein 4e-21 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein VFG0473 Protein 1e-30 48
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein VFG1390 Protein 7e-30 47
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein VFG0596 Protein 7e-21 42
BCAL2831 YP_002231933.1 two-component regulatory system, response regulator protein VFG1389 Protein 6e-21 41