Name : Smlt3363 (Smlt3363) Accession : YP_001973082.1 Strain : Stenotrophomonas maltophilia K279a Genome accession: NC_010943 Putative virulence/resistance : Resistance Product : transmebrane small multidrug resistance transport protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 3405117 - 3405449 bp Length : 333 bp Strand : + Note : similarity:fasta; BPP3465; bparapertussis; putative mebrane transport protein; length 110 aa; id=58.2%; E()=2.3e-22; 110 aa overlap; query 1-110 aa; subject 1-110 aa; similarity:fasta; BB3914; bbronchiseptica; putative mebrane transport protein; length 11 DNA sequence : ATGAATCCCTACCTCTACCTTGCCGCTGCCATCGTGCTGGAAGTGATTGCCACATCACTGCTGAAGGCATCCGACGGCAT GAGCCGGCTGGCGCCGACACTGGGCGCACTGGTCGGCTACGGGCTGTGCTTCTACCTGCTGTCGATGACCATGAAGTCGA TCCCGACCGGCATCGCCTACGCAATCTGGTCAGGCGTCGGCATCGTGCTGATCTCACTGATCGGGCTGGTGGTGTTCAAG CAGCGCCTGGATGCACCGGCGTTGACCGGCATCGGCCTGATCTGCGCCGGCGTACTGGTGATCAACCTGTTCTCGCGCAG CAGCGCGCACTGA Protein sequence : MNPYLYLAAAIVLEVIATSLLKASDGMSRLAPTLGALVGYGLCFYLLSMTMKSIPTGIAYAIWSGVGIVLISLIGLVVFK QRLDAPALTGIGLICAGVLVINLFSRSSAH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 9e-20 | 52 |
qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 9e-20 | 52 |
ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 1e-19 | 52 |
qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 9e-20 | 52 |
qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-20 | 52 |
qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-19 | 52 |
qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-20 | 52 |
qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-19 | 52 |
qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-20 | 52 |
ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 1e-19 | 52 |
qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 9e-20 | 52 |
qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-20 | 52 |
qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 1e-19 | 52 |
qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 9e-20 | 52 |
qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 9e-20 | 52 |
qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 9e-20 | 52 |
qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 9e-20 | 52 |
qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-20 | 52 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | NC_002695.1.913273.p | Protein | 2e-26 | 62 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0150 | Protein | 2e-26 | 61 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0377 | Protein | 2e-26 | 59 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | CP004022.1.gene1549. | Protein | 1e-21 | 58 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0002 | Protein | 3e-22 | 57 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | NC_010410.6003348.p0 | Protein | 3e-22 | 57 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0324 | Protein | 1e-22 | 53 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0322 | Protein | 5e-24 | 53 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | CP001138.1.gene1489. | Protein | 5e-21 | 53 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0323 | Protein | 4e-20 | 52 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0327 | Protein | 4e-21 | 49 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0325 | Protein | 1e-19 | 47 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0192 | Protein | 4e-15 | 47 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0326 | Protein | 9e-18 | 47 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0329 | Protein | 2e-17 | 46 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0139 | Protein | 1e-16 | 44 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0321 | Protein | 6e-23 | 42 |
Smlt3363 | YP_001973082.1 | transmebrane small multidrug resistance transport protein | BAC0477 | Protein | 1e-09 | 42 |