Gene Information

Name : Smlt3363 (Smlt3363)
Accession : YP_001973082.1
Strain : Stenotrophomonas maltophilia K279a
Genome accession: NC_010943
Putative virulence/resistance : Resistance
Product : transmebrane small multidrug resistance transport protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 3405117 - 3405449 bp
Length : 333 bp
Strand : +
Note : similarity:fasta; BPP3465; bparapertussis; putative mebrane transport protein; length 110 aa; id=58.2%; E()=2.3e-22; 110 aa overlap; query 1-110 aa; subject 1-110 aa; similarity:fasta; BB3914; bbronchiseptica; putative mebrane transport protein; length 11

DNA sequence : 
ATGAATCCCTACCTCTACCTTGCCGCTGCCATCGTGCTGGAAGTGATTGCCACATCACTGCTGAAGGCATCCGACGGCAT
GAGCCGGCTGGCGCCGACACTGGGCGCACTGGTCGGCTACGGGCTGTGCTTCTACCTGCTGTCGATGACCATGAAGTCGA
TCCCGACCGGCATCGCCTACGCAATCTGGTCAGGCGTCGGCATCGTGCTGATCTCACTGATCGGGCTGGTGGTGTTCAAG
CAGCGCCTGGATGCACCGGCGTTGACCGGCATCGGCCTGATCTGCGCCGGCGTACTGGTGATCAACCTGTTCTCGCGCAG
CAGCGCGCACTGA

Protein sequence : 
MNPYLYLAAAIVLEVIATSLLKASDGMSRLAPTLGALVGYGLCFYLLSMTMKSIPTGIAYAIWSGVGIVLISLIGLVVFK
QRLDAPALTGIGLICAGVLVINLFSRSSAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-20 52
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-20 52
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-19 52
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-20 52
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-20 52
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-19 52
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-20 52
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-19 52
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-20 52
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-19 52
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-20 52
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-20 52
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-19 52
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-20 52
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-20 52
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-20 52
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-20 52
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-20 52
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-20 52
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-20 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein NC_002695.1.913273.p Protein 2e-26 62
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0150 Protein 2e-26 61
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0377 Protein 2e-26 59
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein CP004022.1.gene1549. Protein 1e-21 58
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0002 Protein 3e-22 57
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein NC_010410.6003348.p0 Protein 3e-22 57
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0324 Protein 1e-22 53
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0322 Protein 5e-24 53
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein CP001138.1.gene1489. Protein 5e-21 53
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0323 Protein 4e-20 52
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0327 Protein 4e-21 49
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0325 Protein 1e-19 47
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0192 Protein 4e-15 47
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0326 Protein 9e-18 47
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0329 Protein 2e-17 46
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0139 Protein 1e-16 44
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0321 Protein 6e-23 42
Smlt3363 YP_001973082.1 transmebrane small multidrug resistance transport protein BAC0477 Protein 1e-09 42