Gene Information

Name : Smlt2693 (Smlt2693)
Accession : YP_001972461.1
Strain : Stenotrophomonas maltophilia K279a
Genome accession: NC_010943
Putative virulence/resistance : Virulence
Product : two-component response regulator transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2714292 - 2714990 bp
Length : 699 bp
Strand : +
Note : similarity:fasta; CAS0586; bcenocepacia; response regulator protein; length 225 aa; id=65.0%; E()=1.5e-51; 226 aa overlap; query 1-226 aa; subject 1-224 aa; similarity:fasta; BPSS1040; bpseudomallei; transcriptional activator protein; length 229 aa; id=64

DNA sequence :
ATGAAACTGCTGATCGTCGAAGACGAACCCAAGACCGGCAACTACCTGCGCCAGGGGCTGATCGAGGCCGGCTACGTGGT
CGATCTCGCCTGCAACGGCGTCGACGGGCTGCACCTGGCCGGCAGCGGCGAGTACCAGCTGGTCATCCTCGACGTGATGC
TGCCCGGCCTGGATGGCTGGAACGTGCTGTCGCGGCTGCGCGAGGCCGGCTGGCAGGTGCCGGTACTGTTCCTGACCGCG
CGCAGCAGCATCGCCGACCGCGTGCAGGGCCTTGAGCTGGGCGCCGACGACTACCTGGCCAAGCCATTCGCCTTCGCCGA
GCTGCTGGCGCGGGTACGCACCCTGCTGCGTCGCGGCCAGGCGCAGCCGCAGGCCGAGCGCATCGTCATCGCCGACCTGG
TGGTGGACACCCTGCGCCGCCGGGTTGAACGCGGCGGCCAGCGCATCACCCTCAGCCAGAAGGAATACACCCTGCTGGAG
CTGCTGGCGCGCCGACGTGGCGAAGTGCTGCCGCGCTCGTTGATCGCTTCGCAGGTGTGGGACATGAATTTCGACAGCGA
CACCAACGTGATCGACGTGGCGATCCGCCGCCTGCGCGCGAAGATCGACGATGACTTCGATGCCAAGCTGATCGTCACCG
TGCGCGGCATGGGCTATGTGCTGGAGGCGCCGGACGACGGTGCAGTGCACAGCGGATGA

Protein sequence :
MKLLIVEDEPKTGNYLRQGLIEAGYVVDLACNGVDGLHLAGSGEYQLVILDVMLPGLDGWNVLSRLREAGWQVPVLFLTA
RSSIADRVQGLELGADDYLAKPFAFAELLARVRTLLRRGQAQPQAERIVIADLVVDTLRRRVERGGQRITLSQKEYTLLE
LLARRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDDFDAKLIVTVRGMGYVLEAPDDGAVHSG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-61 62
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-60 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator BAC0083 Protein 3e-72 69
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator BAC0638 Protein 2e-67 69
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator BAC0111 Protein 4e-72 67
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator BAC0308 Protein 8e-69 66
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator BAC0197 Protein 1e-66 64
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator BAC0125 Protein 4e-67 63
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator BAC0347 Protein 4e-64 61
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_007622.3794948.p0 Protein 2e-37 43
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_003923.1003417.p0 Protein 2e-37 43
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_013450.8614146.p0 Protein 2e-37 43
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_002951.3238224.p0 Protein 2e-37 43
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_007793.3914065.p0 Protein 2e-37 43
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_002758.1121390.p0 Protein 2e-37 43
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_010079.5776364.p0 Protein 2e-37 43
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_002952.2859858.p0 Protein 2e-37 43
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator BAC0487 Protein 8e-31 42
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator HE999704.1.gene1528. Protein 2e-28 42
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_013450.8614421.p0 Protein 4e-34 41
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_007793.3914279.p0 Protein 4e-34 41
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_003923.1003749.p0 Protein 5e-34 41
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_002745.1124361.p0 Protein 4e-34 41
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_009782.5559369.p0 Protein 4e-34 41
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_002951.3237708.p0 Protein 4e-34 41
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_002758.1121668.p0 Protein 4e-34 41
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator NC_009641.5332272.p0 Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator VFG0596 Protein 9e-62 62
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator VFG1390 Protein 3e-44 45
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator VFG1389 Protein 1e-34 44
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator VFG1386 Protein 4e-37 42
Smlt2693 YP_001972461.1 two-component response regulator transcriptional regulator VFG0473 Protein 6e-34 41