Gene Information

Name : rpmJ (Smlt2041)
Accession : YP_001971851.1
Strain : Stenotrophomonas maltophilia K279a
Genome accession: NC_010943
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L36
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0257
EC number : -
Position : 2066617 - 2066742 bp
Length : 126 bp
Strand : -
Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io

DNA sequence :
ATGAAAGTCCTGTCCTCCCTGAAGTCGGCGAAGGCCCGTCACCGCGACTGCAAGGTCGTCCGTCGTCGCGGCAAGATCTT
CGTCATCTGCAAGTCGAACCCGCGTTTCAAGGCGCGTCAGCGCTAA

Protein sequence :
MKVLSSLKSAKARHRDCKVVRRRGKIFVICKSNPRFKARQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmJ YP_001800879.1 50S ribosomal protein L36 Not tested Not named Protein 2e-04 58