Gene Information

Name : Glov_0998 (Glov_0998)
Accession : YP_001951241.1
Strain : Geobacter lovleyi SZ
Genome accession: NC_010814
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1036223 - 1036894 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ppd:Ppro_2957 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGGATCTTAGTGGTTGAAGATGAAAAGAAGGTGGCAGCCTTTATCAAGCGGGGACTTGAGGAGGAAGGGTATCAGGT
TGATGCCGTGCATGATGGCGAAGAGGGGGTCCGTCAGGCACAGGAGCAGCCCTATGACCTGCTGATCCTTGATGTGATGC
TGCCCAGCAAGGATGGCCTCAGCGTGGTACGGGAACTGCGTCAGGCCGGTACGGTGATGCCGGTGTTGATGCTGACGGCC
CGGGACACCACCGATGATATCGTGGCCGGCCTGGATGCCGGGTCTGATGACTACCTGACCAAGCCGTTCGCCTTTGCCGA
ACTGTCGGCCCGGGTGCGGGCTCTTGCCCGGCGGATCGGTCGTGACCGCGGCGCAGAGCTGGTGGTGGCGGACCTGCGGA
TGGATCCGCTTTCACGCAAGGTCTGGCGTGGCGACAAGGAGATCGAGCTGACCATCAAGGAGTACGGGCTGCTGGAGTTC
CTGATGCGCAATGCCGGTACGGTGGTCACCCGCAATATGATTGCCGAGAAGGTCTGGGAGCATTCTTTTGAATCCTTTAC
AAATATTATCGATGTATATGTCAATTATGTGCGTAAAAAGGTGGATAAAGGCTTTGATCGCAAACTGATACACACGGTGC
GCGGTCAGGGCTATACCCTCAAGGCAGAGTAG

Protein sequence :
MRILVVEDEKKVAAFIKRGLEEEGYQVDAVHDGEEGVRQAQEQPYDLLILDVMLPSKDGLSVVRELRQAGTVMPVLMLTA
RDTTDDIVAGLDAGSDDYLTKPFAFAELSARVRALARRIGRDRGAELVVADLRMDPLSRKVWRGDKEIELTIKEYGLLEF
LMRNAGTVVTRNMIAEKVWEHSFESFTNIIDVYVNYVRKKVDKGFDRKLIHTVRGQGYTLKAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-42 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-41 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-51 51
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-48 51
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator BAC0347 Protein 9e-45 50
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-48 50
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-48 49
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-43 49
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-45 49
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-36 44
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-36 44
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-36 44
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-36 44
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-36 44
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-36 44
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-36 44
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-36 44
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-31 43
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-33 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-42 48
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-48 48
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-35 41
Glov_0998 YP_001951241.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-38 41