Gene Information

Name : cusR (BMULJ_04191)
Accession : YP_001948584.1
Strain :
Genome accession: NC_010805
Putative virulence/resistance : Virulence
Product : two-component system copper resistance phosphate regulon response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1112678 - 1113376 bp
Length : 699 bp
Strand : -
Note : COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain, Pseudomonas aeruginosa; CusR protein; KEGG, K07665

DNA sequence :
ATGAAAGTACTGATCATCGAAGACGAACCGAAAGTCGTCGAATATCTGAAGAGCGGACTGACCGAGGAAGGCTGGGTCGT
CGATACCGCGCTCGACGGCGAGGACGGTGCATGGAAGGCGGTCGAGTTCGACTACGACGTGGTCGTGCTCGACGTGATGC
TGCCGAAGCTCGACGGCTTCGGCGTGCTGCGCGCCTTGCGCGCGCAGAAGCAGACGCCCGTCATCATGCTGACTGCGCGC
GACCGCGTCGACGATCGCGTGCGCGGGCTGCGCGGCGGCGCCGACGACTATCTGACCAAGCCGTTCTCGTTCCTCGAACT
GATCGAGCGGCTGCGCGCATTGACGCGTCGCGCGCGCGTGCAGGAATCGACGCTGATCTCGATCGGCGACCTGCGTGTCG
ACCTGATCGGCCGCCGCGCGACGCGCGACGGCACGCGGCTCGATCTGACCGCGCAGGAATTCCAGCTGCTCGGCGTGCTC
GCGCGGCGCAGCGGCGAGGTGCTGTCGAAGACGACGATCGCCGAGCTCGTCTGGGACGTGAATTTCGACAGCAACGCGAA
CGTCGTCGAAACCGCGATCAAGCGGCTGCGCGCGAAGCTCGACGGCCCGTTCCCGGAGAAGCTGCTGCATACGATTCGCG
GCATGGGCTACGTGCTCGAAGCGCGCGACGACGGCGGCGACACGGAGAAGCGCACATGA

Protein sequence :
MKVLIIEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAVEFDYDVVVLDVMLPKLDGFGVLRALRAQKQTPVIMLTAR
DRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGTRLDLTAQEFQLLGVL
ARRSGEVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFPEKLLHTIRGMGYVLEARDDGGDTEKRT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-41 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-40 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator BAC0083 Protein 4e-48 59
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator BAC0125 Protein 1e-52 57
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator BAC0638 Protein 2e-39 55
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator BAC0197 Protein 7e-47 54
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator BAC0111 Protein 3e-45 51
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator BAC0308 Protein 3e-45 50
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator BAC0347 Protein 3e-40 48
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator CP000675.2.gene1535. Protein 7e-30 41
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator CP001918.1.gene5135. Protein 3e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator VFG0596 Protein 1e-41 53
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator VFG1389 Protein 6e-31 48
cusR YP_001948584.1 two-component system copper resistance phosphate regulon response regulator VFG1386 Protein 4e-26 42