Gene Information

Name : BMULJ_03144 (BMULJ_03144)
Accession : YP_001947554.1
Strain :
Genome accession: NC_010804
Putative virulence/resistance : Resistance
Product : MerR family Cd(II)/Pb(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3390872 - 3391303 bp
Length : 432 bp
Strand : +
Note : COG0789: Predicted transcriptional regulators, Pseudomonas aeruginosa

DNA sequence :
ATGAAGATCGGCGAATTGGCCAAAGCGGCCCGCTGCACGCCGGAGACGATCCGCTTCTACGAGAAGGAGGGTCTGATGCC
GGATGCGCAGCGTACCGACTCGAACTATCGCAACTACACCGACGTACACCTCGAGCGGCTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGGCGCACGACGAAATCCGCGCGCTGCTGCGCCTCACCGACACGCCGGGCGACCGCTGCGATTCGATC
AATGCGCTGCTCGACGAACACATCGGACACGTCGATGCGCGCCTCGCGGAACTCACGCATCTGCGCGATCAGCTCACCGA
ACTGCGGCGGCAATGCGTCGGCGAGCATTCGGTCGAAGACTGCGGCATCGTGCATGGGCTCGCGACGATGGAAACCGTCG
CGCCGGCCGCGAAGCGCACGCATCTCGGCTGA

Protein sequence :
MKIGELAKAARCTPETIRFYEKEGLMPDAQRTDSNYRNYTDVHLERLRFIRNCRALDMAHDEIRALLRLTDTPGDRCDSI
NALLDEHIGHVDARLAELTHLRDQLTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRTHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 2e-31 50
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-29 46
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-29 46
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-29 46
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-29 46
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-29 45
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-29 45
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-29 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMULJ_03144 YP_001947554.1 MerR family Cd(II)/Pb(II)-responsive transcriptional regulator BAC0058 Protein 4e-39 56
BMULJ_03144 YP_001947554.1 MerR family Cd(II)/Pb(II)-responsive transcriptional regulator BAC0301 Protein 4e-31 53