Gene Information

Name : BMULJ_02580 (BMULJ_02580)
Accession : YP_001947007.1
Strain :
Genome accession: NC_010804
Putative virulence/resistance : Virulence
Product : OmpR family two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2779369 - 2780031 bp
Length : 663 bp
Strand : -
Note : COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain, Ralstonia solanacearum; KEGG, K02483

DNA sequence : 
ATGCGGATTCTGCTTGTCGAAGACGACCGGATGATTGCCGAAGGCGTGCGCAAGGCGCTGCGCTCGGACGGCTTCGCGGT
CGACTGGGTGCAGGACGGCGAGTCGGCGCTCACGGCGCTCGGCGGCGAGTCCTACGACCTGCTGCTGCTCGATCTCGGCC
TGCCCAAGCGCGACGGCATCGACGTGCTGCGCACGCTGCGCGCGCGCGGGCTGTCGCTGCCGGTGCTGATCGTCACCGCG
CGCGATGCGATCGCCGATCGCGTGAAGGGCCTCGACGCGGGCGCCGACGACTATCTCGTCAAGCCGTTCGATCTCGACGA
ACTCGGCGCGCGGATGCGCGCGCTGATCCGCCGGCAGGCCGGGCGCAGCGAGTCGCTGATCCGCCACGGCGCGCTGACGC
TCGATCCGGCATCGCACCAGGTGACGCTCGACGGCGCGCCGGTCGCGCTGTCCGCGCGCGAATTCGCGCTGCTCGAGGCG
CTGCTCGCGCGGCCGGGCGCCGTGCTGTCGAAGAGCCAGCTCGAGGAGAAGATGTACGGCTGGGGCGAGGAAATCGGCAG
CAACACGGTCGAGGTCTATATCCACGCACTGCGCAAGAAGCTCGGTTCGGACCTGATCCGCAACGTGCGCGGGCTCGGCT
ACATGGTCGTCAAGGAAAGCTGA

Protein sequence : 
MRILLVEDDRMIAEGVRKALRSDGFAVDWVQDGESALTALGGESYDLLLLDLGLPKRDGIDVLRTLRARGLSLPVLIVTA
RDAIADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQAGRSESLIRHGALTLDPASHQVTLDGAPVALSAREFALLEA
LLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-32 51
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-20 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator BAC0487 Protein 1e-28 47
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator BAC0197 Protein 8e-25 45
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator BAC0083 Protein 3e-22 44
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator NC_002516.2.879194.p Protein 2e-22 43
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator BAC0638 Protein 3e-21 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator VFG0473 Protein 8e-31 47
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator VFG1390 Protein 2e-29 46
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator VFG0596 Protein 5e-21 42
BMULJ_02580 YP_001947007.1 OmpR family two-component system response regulator VFG1389 Protein 5e-21 41