Gene Information

Name : merR (BMULJ_00969)
Accession : YP_001945451.1
Strain :
Genome accession: NC_010804
Putative virulence/resistance : Resistance
Product : MerR family mercuric resistance operon regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1039903 - 1040310 bp
Length : 408 bp
Strand : +
Note : COG0789: Predicted transcriptional regulators, Sinorhizobium meliloti; KEGG, K08365

DNA sequence :
ATGAAAGAACTAACCGAAATACTGACAATCGGAGTCTTGGCCGAGGCCGCCGGGGTGAATGTCGAGACGATCCGCTTCTA
TCAACGCAAGGGCCTGATGCAGGAGCCTGACCGGCCACTTGGCGGTATCCGTCGCTACGGGGAGCCGGATTTGGCACGCG
TGCGCTTCATCAAGTCGGCCCAGCGACTAGGGTTCAGCTTGGACGAGATCGGCGACTTGCTGAAGCTCGAGGATGGGTCG
CACTGCACCGAGGCCCGCGAACAGGCCGAACGCAAGCTCGCGGATGTGCGCGCCAAGCTCGCCGATCTTCACCGCATTGA
GGCAGTCCTGGAAGATCTGGTGCAGCGCTGCTGCGCCGCACGGGGACAGGTGCGCTGCCCGATGATCCAGGCACTTCAGG
AGGCGTGA

Protein sequence :
MKELTEILTIGVLAEAAGVNVETIRFYQRKGLMQEPDRPLGGIRRYGEPDLARVRFIKSAQRLGFSLDEIGDLLKLEDGS
HCTEAREQAERKLADVRAKLADLHRIEAVLEDLVQRCCAARGQVRCPMIQALQEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 3e-41 70
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 4e-41 70
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 6e-44 69
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 3e-40 67
merR AFG30124.1 MerR Not tested PAGI-2 Protein 3e-40 67
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 5e-40 67
merR ACK44535.1 MerR Not tested SGI1 Protein 3e-40 67
merR AGK07025.1 MerR Not tested SGI1 Protein 2e-39 66
merR AGK07083.1 MerR Not tested SGI1 Protein 2e-39 66
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 9e-38 64
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-27 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_001945451.1 MerR family mercuric resistance operon regulatory protein BAC0688 Protein 2e-41 70
merR YP_001945451.1 MerR family mercuric resistance operon regulatory protein BAC0232 Protein 4e-41 69
merR YP_001945451.1 MerR family mercuric resistance operon regulatory protein BAC0687 Protein 4e-41 69
merR YP_001945451.1 MerR family mercuric resistance operon regulatory protein BAC0686 Protein 4e-41 68
merR YP_001945451.1 MerR family mercuric resistance operon regulatory protein BAC0684 Protein 7e-41 66
merR YP_001945451.1 MerR family mercuric resistance operon regulatory protein BAC0683 Protein 8e-41 66
merR YP_001945451.1 MerR family mercuric resistance operon regulatory protein BAC0689 Protein 1e-39 66
merR YP_001945451.1 MerR family mercuric resistance operon regulatory protein BAC0682 Protein 3e-21 42