Gene Information

Name : vicR (BMULJ_06140)
Accession : YP_001941929.1
Strain :
Genome accession: NC_010801
Putative virulence/resistance : Virulence
Product : OmpR family two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 878570 - 879289 bp
Length : 720 bp
Strand : -
Note : COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain, Thermotoga maritima; KEGG, K07668; VicR protein

DNA sequence :
ATGGACCATCCGAAACGCATCCTGATCGTCGAGGACGACGCCGACATCGCCGACGTGCTGAGCCTGCATCTGCGCGACGA
ACGCTACGAGGTCGTGCATAGCGCGGACGGCGCGCAAGGGCTGCGGCTGCTGGAACAGGGCGGCTGGGACGCGCTGATCC
TCGATCTGATGCTGCCCGGCGTCGACGGCCTCGAAATCTGCCGGCGCGCGCGCGCGATGGCGCGCTACACGCCGATCATC
ATCACGAGCGCGCGTTCGAGCGAGGTGCACCGGATCCTCGGCCTCGAAATCGGCGCGGACGACTATCTCGCGAAGCCGTT
TTCGGTGCTCGAACTGGTGGCGCGCGTGAAGGCGCTGCTGCGGCGCGTCGACGCGCTCGCGCGCGATTCGCGGATCGATG
CGGGCACGCTCGACGTCGCGGGACTGTCGATCGACCCCATCGCGCGCGAGGCCAGCGTCGACGGCACGCGCATCGACCTG
ACGCCGCGCGAGTTCGATCTGCTGTACTTCTTCGCGCGCCATCCGGGCAAGGTGTTCTCGCGCATGGATCTGCTCAATGC
GGTATGGGGCTATCAGCACGAAGGCTACGAGCACACGGTGAACACGCACATCAACCGGCTGCGCGCGAAGATCGAGGCCG
ATCCGGCCGAGCCCGTGCGGATCCTGACCGTGTGGGGGCGCGGCTACAAGCTCGCGGCCCCCGAGCAGCGGGACGCATGA

Protein sequence :
MDHPKRILIVEDDADIADVLSLHLRDERYEVVHSADGAQGLRLLEQGGWDALILDLMLPGVDGLEICRRARAMARYTPII
ITSARSSEVHRILGLEIGADDYLAKPFSVLELVARVKALLRRVDALARDSRIDAGTLDVAGLSIDPIAREASVDGTRIDL
TPREFDLLYFFARHPGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKIEADPAEPVRILTVWGRGYKLAAPEQRDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-72 61
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-72 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_001941929.1 OmpR family two-component system response regulator AE000516.2.gene3505. Protein 1e-38 45
vicR YP_001941929.1 OmpR family two-component system response regulator NC_012469.1.7685629. Protein 5e-42 45
vicR YP_001941929.1 OmpR family two-component system response regulator NC_002758.1121390.p0 Protein 1e-35 43
vicR YP_001941929.1 OmpR family two-component system response regulator NC_010079.5776364.p0 Protein 1e-35 43
vicR YP_001941929.1 OmpR family two-component system response regulator NC_002952.2859858.p0 Protein 1e-35 43
vicR YP_001941929.1 OmpR family two-component system response regulator NC_007622.3794948.p0 Protein 1e-35 43
vicR YP_001941929.1 OmpR family two-component system response regulator NC_003923.1003417.p0 Protein 1e-35 43
vicR YP_001941929.1 OmpR family two-component system response regulator NC_013450.8614146.p0 Protein 1e-35 43
vicR YP_001941929.1 OmpR family two-component system response regulator NC_002951.3238224.p0 Protein 1e-35 43
vicR YP_001941929.1 OmpR family two-component system response regulator NC_007793.3914065.p0 Protein 1e-35 43
vicR YP_001941929.1 OmpR family two-component system response regulator HE999704.1.gene1528. Protein 6e-34 43
vicR YP_001941929.1 OmpR family two-component system response regulator AF155139.2.orf0.gene Protein 2e-42 43
vicR YP_001941929.1 OmpR family two-component system response regulator AE015929.1.gene1106. Protein 1e-30 42
vicR YP_001941929.1 OmpR family two-component system response regulator HE999704.1.gene2815. Protein 1e-40 42
vicR YP_001941929.1 OmpR family two-component system response regulator CP001138.1.gene2239. Protein 3e-31 42
vicR YP_001941929.1 OmpR family two-component system response regulator CP001918.1.gene3444. Protein 2e-31 42
vicR YP_001941929.1 OmpR family two-component system response regulator BAC0039 Protein 3e-32 42
vicR YP_001941929.1 OmpR family two-component system response regulator BAC0596 Protein 3e-31 42
vicR YP_001941929.1 OmpR family two-component system response regulator CP000034.1.gene2186. Protein 3e-32 42
vicR YP_001941929.1 OmpR family two-component system response regulator NC_002695.1.916589.p Protein 3e-32 42
vicR YP_001941929.1 OmpR family two-component system response regulator FJ349556.1.orf0.gene Protein 8e-39 41
vicR YP_001941929.1 OmpR family two-component system response regulator AE016830.1.gene1681. Protein 9e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
vicR YP_001941929.1 OmpR family two-component system response regulator VFG1563 Protein 3e-72 61
vicR YP_001941929.1 OmpR family two-component system response regulator VFG1702 Protein 3e-72 61
vicR YP_001941929.1 OmpR family two-component system response regulator VFG1389 Protein 2e-31 45