Gene Information

Name : Nther_2903 (Nther_2903)
Accession : YP_001919038.1
Strain : Natranaerobius thermophilus JW/NM-WN-LF
Genome accession: NC_010718
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3135683 - 3136387 bp
Length : 705 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: spn:SP_1227 DNA-binding response regulator

DNA sequence :
ATGAGTTACAGAGTTTTAATTGTAGAAGATGAACAACCTATAGCTGATATCATTAATTTCAATCTTGTCAAAGAAGGGTA
TGAAACAGAGGTCGCCTATAATGGTGAAGATGGATTAGAGAAGTTTGCCAGCTTTTCTCCACACATAATAGTTTTAGACC
TGATGTTACCTGGAAAAGATGGTTTTTCAGTTTGTAAGGAGATTCGCTCCCAAAGTTCGGTTCCCATTTTAGTATTAACA
GCCAAGGATTCGGAAGTTGATAAGGTGTTGGGATTAGAATTGGGAGCAGATGATTACGTTACTAAGCCCTTTGGAAACAG
AGAACTGTTAGCCAGGATTAAGGCCTTACTCCGAAGAGTCAATTTATCTGGGCAAGATTCTTCAAGTAGTGAAAAAGATG
AGGATATTTTGAAGTATAACGATGTTGAAATAAATCTAAAAACTGCTGAAGTAAAAAAACAGGGGCAAGCCATAGATCTG
ACTTATCGGGAATTTCAATTATTCGTTTATTTAGTCAAACGACAAGGAGAAGTAATTTCTCGGGAACGGATGATTGAAGA
AGTCTGGGGATACGACTTTATTGGGGAAGACCGTACCGTTGATGTTACCATTAGGCGCTTAAGAGAGAAATTAGAAGATG
ATCCAGGGAGCCCAAGCTATATAATGACTAAAAGAGGTATGGGTTATTACCTTAGGAGGACTTAA

Protein sequence :
MSYRVLIVEDEQPIADIINFNLVKEGYETEVAYNGEDGLEKFASFSPHIIVLDLMLPGKDGFSVCKEIRSQSSVPILVLT
AKDSEVDKVLGLELGADDYVTKPFGNRELLARIKALLRRVNLSGQDSSSSEKDEDILKYNDVEINLKTAEVKKQGQAIDL
TYREFQLFVYLVKRQGEVISRERMIEEVWGYDFIGEDRTVDVTIRRLREKLEDDPGSPSYIMTKRGMGYYLRRT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-63 57
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-54 50
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-54 49
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-44 46
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-37 45
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-47 45
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-45 44
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-33 43
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 3e-36 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 3e-36 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 3e-36 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 3e-36 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 3e-36 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 3e-36 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 3e-36 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 3e-36 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 5e-35 42
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 8e-31 41
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family BAC0308 Protein 8e-31 41
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 5e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nther_2903 YP_001919038.1 two component transcriptional regulator, winged helix family VFG0596 Protein 3e-34 41