
|
Name : ETA_24310 (ETA_24310) Accession : YP_001908354.1 Strain : Erwinia tasmaniensis Et1/99 Genome accession: NC_010694 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 2738676 - 2738873 bp Length : 198 bp Strand : - Note : silverDB:etchr02419; phage-related protein (prophage CP4-57 regulatory protein) DNA sequence : ATGTCACAAAATCTCATCCGCATGCCGGAAGTTCTCCGGCGCATAGGTCTTGGTAAGGCTTGGGTATATAAACTTATTTC TCAAGGGATATTCCCAAAACCAGTAAAAATTGGATCACGCTCTATCGCTTTCGTTGAAAGTGAAATAGACGCATGGATTA ATCAGCGTATCGCAGAGCGTGACGGGGAGGCGGCATAA Protein sequence : MSQNLIRMPEVLRRIGLGKAWVYKLISQGIFPKPVKIGSRSIAFVESEIDAWINQRIAERDGEAA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 5e-08 | 46 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 8e-08 | 46 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 3e-09 | 45 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 45 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 45 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 3e-05 | 44 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 3e-05 | 44 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 1e-07 | 43 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 4e-08 | 41 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 6e-08 | 41 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 9e-08 | 41 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-07 | 41 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-07 | 41 |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 1e-07 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ETA_24310 | YP_001908354.1 | hypothetical protein | VFG1480 | Protein | 2e-08 | 46 |
| ETA_24310 | YP_001908354.1 | hypothetical protein | VFG1141 | Protein | 1e-09 | 45 |
| ETA_24310 | YP_001908354.1 | hypothetical protein | VFG0651 | Protein | 4e-08 | 41 |