Gene Information

Name : Rpic_0470 (Rpic_0470)
Accession : YP_001898057.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 503980 - 504690 bp
Length : 711 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rso:RSc0550 probable response regulator transcription regulator protein

DNA sequence : 
ATGCGCATCCTGATTGCCGAAGACGACGCCACGCTGGCTGACGGGCTCACACGCTCGCTGCGCCAGGCGGGCTACGCCGT
CGACCAAGCCTCCGATGGGGCGACTGCCGACGCGGCGCTGTCCGCGCAAACGGCCCAGACCTATGACCTGCTGATCCTCG
ACGTGGGACTGCCGCGTATGTCGGGGCTGGAGGTCCTTAAGCGCCTGCGCTCGCGCGGGGCCATGCTGCCGGTGCTGATC
CTGACCGCCGCCGACAGCGTGGAAGAACGAGTCAAGGGGCTGGATCTTGGCGCCGACGATTACATGGCCAAACCGTTCGC
GCTGTCCGAGCTGGAAGCGCGCGTGCGTGCGCTGGTGCGGCGCGGCACGGGCGGCGGCGCCACGCTCGTGCGCCATGGGC
CGCTGGCATTCGACCAGGTCGGGCGCATTGCCTATATCCACGATCAGGTGGTGGAACTGTCGGCACGCGAGATCGGGCTG
CTGGAGATTCTGCTGGCGCGCGTGGGCCGCCTGGTGTCGAAAGAGCAACTGGTCGACCATCTGTGCGGCTGGGGCGAAGA
AGTCAGCAACAACGCCATCGAGGTCTACATCCACCGCCTGCGCAAGAAGATCGAAGTGGAAGGCATCCGCATCGCCACCG
TGCGCGGGCTGGGCTATTGCCTGGAACGCACGGCCACCCCAACCACCACCGCGACCGCTGCCCATGGGTGA

Protein sequence : 
MRILIAEDDATLADGLTRSLRQAGYAVDQASDGATADAALSAQTAQTYDLLILDVGLPRMSGLEVLKRLRSRGAMLPVLI
LTAADSVEERVKGLDLGADDYMAKPFALSELEARVRALVRRGTGGGATLVRHGPLAFDQVGRIAYIHDQVVELSAREIGL
LEILLARVGRLVSKEQLVDHLCGWGEEVSNNAIEVYIHRLRKKIEVEGIRIATVRGLGYCLERTATPTTTATAAHG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-32 45
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator BAC0487 Protein 4e-33 44
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-29 43
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-27 43
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-28 42
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-30 41
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator BAC0308 Protein 7e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator VFG1390 Protein 8e-32 44
Rpic_0470 YP_001898057.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-34 44