Gene Information

Name : Rpic_3542 (Rpic_3542)
Accession : YP_001901093.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3711037 - 3711495 bp
Length : 459 bp
Strand : -
Note : TIGRFAM: Cu(I)-responsive transcriptional regulator; PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: rso:RSc3347 probable transcription regulator protein

DNA sequence : 
ATGACGCGCACCCATCTCATCGACCCAGGCCCCGTCAACATTGGCGAGGCCGCAAAGGCCAGTGGCGTGTCGGCCAAGAT
GATCCGCTACTACGAGAGTATCGGCCTGCTGCCGCCGAGTCCGCGCACCGAAGGCAACTACCGCATGTACGACGCGCGGG
CGTTGCATGTGCTGCGCTTTATCCACAGGTCGCGCTCTCTGGGTTTCGCGCTGGAGGAGATCCGCACGCTGCTGTCGTTG
TGGAACGACCGCGAACGCGCCAGCGCCGATGTGAAAGCTGTCACCCTGCGCCACGTGGCGGATCTCGATGCGCGCATCAG
CGAGCTGCAAAGCATGCGCGACACGCTCATGACGCTTGCCAACGCCTGCCACGGCGATGACCGCCCCGATTGCCCGATCC
TCCAGAGCGTGGCCGGCGAGGGTGATGAAGGCGGCGGCACCGATGCCTGCTGCCACTGA

Protein sequence : 
MTRTHLIDPGPVNIGEAAKASGVSAKMIRYYESIGLLPPSPRTEGNYRMYDARALHVLRFIHRSRSLGFALEEIRTLLSL
WNDRERASADVKAVTLRHVADLDARISELQSMRDTLMTLANACHGDDRPDCPILQSVAGEGDEGGGTDACCH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 8e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_3542 YP_001901093.1 MerR family transcriptional regulator BAC0190 Protein 2e-39 58
Rpic_3542 YP_001901093.1 MerR family transcriptional regulator BAC0182 Protein 2e-33 54
Rpic_3542 YP_001901093.1 MerR family transcriptional regulator BAC0569 Protein 3e-31 52
Rpic_3542 YP_001901093.1 MerR family transcriptional regulator BAC0105 Protein 1e-28 49
Rpic_3542 YP_001901093.1 MerR family transcriptional regulator BAC0462 Protein 1e-23 41