Gene Information

Name : Rpic_1742 (Rpic_1742)
Accession : YP_001899312.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1837203 - 1837889 bp
Length : 687 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: reh:H16_B2186 response regulator of copper response,OmpR-family

DNA sequence :
ATGAAACTGCTCGTCGTAGAGGACGAATCCAAGACAGGCCAGTACCTGCGCCAGGGATTGACCGAGGCCGGATTCGTTGT
CGACCTGGTTGGCAACGGGCTTGATGGACAACACCTGGCGCTCAACGAGTCTTACGATCTGATTATTCTCGACGTCATGC
TGCCGGACCTCGATGGCTGGAGAATTCTGCTGAGCCTGCGCGCGGCCGAGAGCGCGGTTCCGGTCTTGTTCCTTACTGCC
CGCGACAGCGTCGCTGATCGGGTCAAGGGACTGGAGCTCGGCGCGGACGATTACCTGGTAAAGCCATTTGCATTCTCCGA
ACTGTTGGCTCGCGTCCGGACGCTGCTGCGCCGCGGCACTGTGCAGATGGGGCTGGACCGCATTCAGGTGGGCGACCTGG
TGCTTGATCTTAGTCGACGTCGCGCTTCGCGCGGAGGTCGCCGGATAGCGCTGACCAGCAAGGAGTTTGCGCTGCTCGAA
CTGCTCGCCCGCAGGCGGGGAGAAGTTCTGCCCCGCTCGTTGATTGCGTCCCAGGTGTGGGATATGAACTTCGACAGCGA
CAGCAATGTGATCGACGTTGCGATTCGCCGCTTGCGAGCCAAGATCGACGACGACTTCGACGCCAAGCTGATTCAGACGG
TGCGAGGCATGGGGTACGTGCTGGAAGCGCCCGAGGGGCAAGAATGA

Protein sequence :
MKLLVVEDESKTGQYLRQGLTEAGFVVDLVGNGLDGQHLALNESYDLIILDVMLPDLDGWRILLSLRAAESAVPVLFLTA
RDSVADRVKGLELGADDYLVKPFAFSELLARVRTLLRRGTVQMGLDRIQVGDLVLDLSRRRASRGGRRIALTSKEFALLE
LLARRRGEVLPRSLIASQVWDMNFDSDSNVIDVAIRRLRAKIDDDFDAKLIQTVRGMGYVLEAPEGQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-52 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-51 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 2e-60 73
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 1e-62 70
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 2e-64 69
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 1e-56 66
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 1e-54 64
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 5e-54 63
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 1e-54 63
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 1e-28 43
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 1e-28 43
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 1e-28 43
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 1e-28 43
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 1e-28 43
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 1e-28 43
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 1e-28 43
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 1e-28 43
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator BAC0487 Protein 1e-26 42
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-25 41
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 1e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 1e-52 60
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 2e-33 45
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 2e-27 45
Rpic_1742 YP_001899312.1 winged helix family two component heavy metal response transcriptional regulator VFG0473 Protein 1e-25 41