Gene Information

Name : Rpic_1642 (Rpic_1642)
Accession : YP_001899212.1
Strain :
Genome accession: NC_010682
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1725597 - 1726028 bp
Length : 432 bp
Strand : -
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: rme:Rmet_5946 transcriptional regulator, MerR family

DNA sequence : 
ATGAACATTCAGATCGGTGAATTCGCCAAGCGCACGGCCTGCCCGATTCAAACCATCCGGTACTACGAGCGCGAAGGCCT
GTTGCCGCCGCCGGACCGCAGCTCGGGCAACTTCCGGCTGTACAGCGAGCGGCACATTGAGCGGCTGCAGTTCATCCTCC
ACTGCCGGTCATTGGACATGCCGCTGAACGACGTGCGGACACTCCTGCGCTACCGCGAGCGACCGGACGAGGATTGCGGC
GCGGTGAACACCCTCCTGGACAAGCACATCGAGGAAGTCGAGCGGCGTATCGAGGCACTGGGGGTGTTAAAGCACCATTT
GTGCGCGCTGCGCGAGACCTGTTCCGACGGGCGAGCTGCAGAAGCTTGCGGAATCCTGCAGGGGTTGTCCGAAGGTAGCG
GCACGTGCACTGGAGACGGCACGCACCGCTGA

Protein sequence : 
MNIQIGEFAKRTACPIQTIRYYEREGLLPPPDRSSGNFRLYSERHIERLQFILHCRSLDMPLNDVRTLLRYRERPDEDCG
AVNTLLDKHIEEVERRIEALGVLKHHLCALRETCSDGRAAEACGILQGLSEGSGTCTGDGTHR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 3e-33 50
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 2e-33 50
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-33 50
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 2e-33 50
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-32 49
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 7e-33 49
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 5e-33 49
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 4e-33 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rpic_1642 YP_001899212.1 MerR family transcriptional regulator BAC0301 Protein 1e-33 58
Rpic_1642 YP_001899212.1 MerR family transcriptional regulator BAC0058 Protein 2e-36 50