Gene Information

Name : Bphyt_3267 (Bphyt_3267)
Accession : YP_001896882.1
Strain :
Genome accession: NC_010681
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3681767 - 3682429 bp
Length : 663 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bxe:Bxe_A0699 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGCATCTTGCTAGTCGAAGACGACCGGATGATTGCTGAAGGCGTGCGCAAAGCGTTGCGCGGCGAAGGCTTCGCGGT
CGACTGGGTGGAAGACGGCGAAGCGGCGCTCAGCGCGGCAGGCAGCCAGCCTTACGATCTCGTGTTGCTCGACCTGGGCC
TGCCCAAACGCGACGGTCTCGACGTGCTCCGCACGCTGCGCGCGCGCGGCCACGCGCTGCCGGTGCTGATCGTGACCGCG
CGCGACGCCGTAGCGGATCGTGTCAAAGGCCTCGACGCCGGCGCCGACGATTACCTCGTCAAACCCTTCGATCTCGACGA
ACTCGGCGCCCGCATGCGCGCGCTGATCCGGCGTCAATCCGGACGCAGCGATTCGACCATCCGGCACGGCAACCTGACGC
TCGATCCGGCCTCGCATCAGGTCACGCTCGACGGCGCGCCGGTCGCGTTATCGGCGCGTGAATTCGCGCTGCTCGAGGCG
CTGCTCGCGCGTCCTGGCGCCGTGCTCTCGAAGAGCCAGCTCGAAGAAAAAATGTACGGCTGGGGCGAGGAAATCGGCAG
CAACACCGTCGAGGTCTACATTCACGCGCTGCGCAAGAAACTCGGCGCGGAGCTGATCCGCAACGTGCGCGGTCTGGGCT
ACATGATCGCGAAGGACGCCTGA

Protein sequence :
MRILLVEDDRMIAEGVRKALRGEGFAVDWVEDGEAALSAAGSQPYDLVLLDLGLPKRDGLDVLRTLRARGHALPVLIVTA
RDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQSGRSDSTIRHGNLTLDPASHQVTLDGAPVALSAREFALLEA
LLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGAELIRNVRGLGYMIAKDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 9e-41 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-28 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-39 50
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-35 45
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-29 44
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-31 43
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-29 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-39 48
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-35 46
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-26 43
Bphyt_3267 YP_001896882.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-29 42