Gene Information

Name : rpmE2 (Bphyt_1820)
Accession : YP_001895452.1
Strain :
Genome accession: NC_010681
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L31
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0254
EC number : -
Position : 2042952 - 2043218 bp
Length : 267 bp
Strand : -
Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g

DNA sequence :
ATGAAAGAAGGCATTCACCCGGATTACCGCGAAGTTCTGTTCATCGACGTGTCGAACGACTTCAAGTTCGTGACGCGCTC
GACCATCCAGACGCGTGAAACCGCAGAATTCGAAGGCAAGACCTACCCGCTCGCCAAGATCGAAGTGTCGTCGGAATCGC
ATCCGTTCTACACCGGCCAGCAAAAGATCATGGACACGGCAGGCCGCGTCGAGAAGTTCCGCAACAAGTTCGGCTCGCGC
GCTACCGGCAAGGCAGTCGCGAAGTAA

Protein sequence :
MKEGIHPDYREVLFIDVSNDFKFVTRSTIQTRETAEFEGKTYPLAKIEVSSESHPFYTGQQKIMDTAGRVEKFRNKFGSR
ATGKAVAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmE2 NP_286687.1 50S ribosomal protein L31 Not tested TAI Protein 2e-12 49
rpmE2 NP_287095.1 50S ribosomal protein L31 Not tested TAI Protein 2e-12 49