Gene Information

Name : Bphyt_4933 (Bphyt_4933)
Accession : YP_001888667.1
Strain :
Genome accession: NC_010676
Putative virulence/resistance : Virulence
Product : two component heavy metal response winged helix family transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1064076 - 1064747 bp
Length : 672 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bxe:Bxe_B1748a hypothetical protein

DNA sequence :
ATGACTATCCTCGTCATCGAAGACGATCCGAAAACCGGCGACTACCTGAAGAAGGGTTTGCGCGAGAGCGGCTATGCGGT
CGATCTCGCGCGTACCGGCACGGACGGTCTGCATATGGCGCTCGAAAATGCGTACGACCTCGTGGTGCTGGACGTGATGC
TGCCCGGCATCGACGGCTGGGAAATCATGCGTGCTTTGCGCACGCGGCGCGATCTGCCGGTGATTTTCCTGACCGCGCGC
GACCACGTCAGCGATCGCATTCGCGGCCTCGAACTCGGTGCGGACGATTATCTCGTCAAGCCGTTTTCATTTACGGAGCT
GGTGCTGAGGATCCGAACGCTGCTGCGCCGCGGCGTGATCCGCGAGAGCGATGTATTCGAAATCGCCGACCTCAAGCTCG
ACGTACTGCGCCGCAAGGTGACGCGCGAAGGCGTCGAGATTCCGCTCACCAACAAGGAATTCATGCTGCTGCATCTGCTG
GTGCGCCGTCAGGGCGAAGCGCTGTCGCGCACGCAGATCGCCTCCGAAGTGTGGGACATGAATTTCGACAGCGACACCAA
CGTGGTCGACGTGGCCATCAAACGGCTGCGCGCCAAAGTCGATCATCCATTTGAAAAGAAGCTGATCCACACGGTGCGCA
GCATCGGCTATACCTTCGGCGACGGCTCATGA

Protein sequence :
MTILVIEDDPKTGDYLKKGLRESGYAVDLARTGTDGLHMALENAYDLVVLDVMLPGIDGWEIMRALRTRRDLPVIFLTAR
DHVSDRIRGLELGADDYLVKPFSFTELVLRIRTLLRRGVIRESDVFEIADLKLDVLRRKVTREGVEIPLTNKEFMLLHLL
VRRQGEALSRTQIASEVWDMNFDSDTNVVDVAIKRLRAKVDHPFEKKLIHTVRSIGYTFGDGS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-61 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-60 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator BAC0125 Protein 8e-69 62
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator BAC0197 Protein 2e-66 62
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator BAC0083 Protein 3e-65 61
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator BAC0111 Protein 2e-65 59
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator BAC0308 Protein 4e-61 58
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator BAC0638 Protein 5e-56 57
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator BAC0347 Protein 6e-56 55
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator NC_003923.1003417.p0 Protein 4e-40 43
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator NC_013450.8614146.p0 Protein 4e-40 43
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator NC_002951.3238224.p0 Protein 4e-40 43
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator NC_007793.3914065.p0 Protein 4e-40 43
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator NC_002758.1121390.p0 Protein 4e-40 43
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator NC_010079.5776364.p0 Protein 4e-40 43
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator NC_002952.2859858.p0 Protein 4e-40 43
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator NC_007622.3794948.p0 Protein 4e-40 43
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator AE015929.1.gene1106. Protein 7e-35 42
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator Y16952.3.orf35.gene. Protein 7e-27 41
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator AE000516.2.gene3505. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator VFG0596 Protein 3e-61 59
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator VFG1389 Protein 6e-36 44
Bphyt_4933 YP_001888667.1 two component heavy metal response winged helix family transcriptional regulator VFG1390 Protein 3e-39 43