Gene Information

Name : SbBS512_A0035 (SbBS512_A0035)
Accession : YP_001883096.1
Strain :
Genome accession: NC_010660
Putative virulence/resistance : Unknown
Product : IS66 family element, Orf2 protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 19991 - 20338 bp
Length : 348 bp
Strand : +
Note : identified by match to protein family HMM PF05717

DNA sequence :
ATGATATCTTTCCCTGCAGGTTCGCGTATCTGGCTGGTTGCAGGTATCACCGATATGCGAAATGGCTTTAACGGTCTGGC
CTCAAAAGTTCAGAACGTCCTGAAGGATGACCCGTTCTCCGGGCATCTGTTCATCTTCCGCGGACGCCGGGGTGACCAGA
TAAAAGTGTTGTGGGCTGACAGTGACGGACTGTGCCTCTTTACCAGACGCCTGGAGCGGGGCCGCTTCGTCTGGCCGGTC
ACCCGTGACGGCAAGGTGCACCTTACTCCGGCCCAGTTATCCATGCTTCTTGAGGGCATCGACTGGAAACACCCGAAACG
AACGGAACGCGCTGGCATCCGCATATAA

Protein sequence :
MISFPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLFIFRGRRGDQIKVLWADSDGLCLFTRRLERGRFVWPV
TRDGKVHLTPAQLSMLLEGIDWKHPKRTERAGIRI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-49 98
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-49 98
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-49 97
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-44 80
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-44 80
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-39 76
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-39 76
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-38 75
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-38 75
unnamed AAC31493.1 L0014 Not tested LEE Protein 9e-39 75
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-38 75
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 9e-39 75
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-38 75
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 8e-38 75
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 8e-38 75
unnamed AAL99258.1 unknown Not tested LEE Protein 9e-39 75
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 9e-39 75
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 8e-30 74
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-38 74
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-38 69
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-38 69
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-37 68
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-37 68
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-38 68
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-30 60
Z1163 NP_286698.1 hypothetical protein Not tested TAI Protein 2e-09 42
Z1602 NP_287106.1 hypothetical protein Not tested TAI Protein 2e-09 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SbBS512_A0035 YP_001883096.1 IS66 family element, Orf2 protein VFG1665 Protein 2e-49 97
SbBS512_A0035 YP_001883096.1 IS66 family element, Orf2 protein VFG1698 Protein 9e-40 76
SbBS512_A0035 YP_001883096.1 IS66 family element, Orf2 protein VFG1709 Protein 3e-39 75
SbBS512_A0035 YP_001883096.1 IS66 family element, Orf2 protein VFG0792 Protein 3e-39 75
SbBS512_A0035 YP_001883096.1 IS66 family element, Orf2 protein VFG1517 Protein 3e-30 74
SbBS512_A0035 YP_001883096.1 IS66 family element, Orf2 protein VFG1052 Protein 6e-39 74
SbBS512_A0035 YP_001883096.1 IS66 family element, Orf2 protein VFG1737 Protein 2e-38 68