Gene Information

Name : SbBS512_A0288 (SbBS512_A0288)
Accession : YP_001883291.1
Strain :
Genome accession: NC_010660
Putative virulence/resistance : Unknown
Product : transposase subfamily
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 196863 - 197210 bp
Length : 348 bp
Strand : -
Note : identified by match to protein family HMM PF01527

DNA sequence : 
ATGACTAAAAATACTCGTTTTTCCCCCGAAGTCCGTCAACGGGCAGTCCGTATGGTTCTGGAAAGTCAGGGCGAATATGA
CTCACAATGGGCGACAATTTGTTCCATTGCTCCAAAGATTGGCTGTACGCCGGAGACTCTGCGTGTCTGGGTTCGCCAGC
ATGAGCGGGATACCGGGGGCGGTGATGGAGGGCTCACCACCGCTGAACGTCAGCGTCTGAAAGAGCTGGAGCGTGAAAAT
CGTGAACCACGGCAGCCTGACGGCTGCAAATTGAAACCCGCCCCTGTTCGTCCTGTTGTTGCCGCACGCTCCGCAGAATA
TGTATGCTCTGAGGACCTGTTTTATTAA

Protein sequence : 
MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTPETLRVWVRQHERDTGGGDGGLTTAERQRLKELEREN
REPRQPDGCKLKPAPVRPVVAARSAEYVCSEDLFY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAF09023.1 unknown Not tested SHI-O Protein 5e-27 95
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 5e-27 95
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 6e-26 94
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 1e-26 94
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-26 94
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-26 94
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-26 94
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 2e-26 94
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 2e-26 94
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 1e-25 94
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 2e-27 93
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 2e-27 93
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 2e-27 93
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 2e-27 93
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 5e-27 90
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 2e-25 90
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 7e-27 90
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 5e-27 90
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-26 90
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 5e-27 90
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 1e-26 90
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 5e-27 90
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 1e-26 90
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-24 89
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-24 89
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 1e-24 89
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 2e-24 89
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 1e-24 89
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 5e-24 88
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 3e-24 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SbBS512_A0288 YP_001883291.1 transposase subfamily VFG0643 Protein 5e-27 94
SbBS512_A0288 YP_001883291.1 transposase subfamily VFG0606 Protein 2e-26 94
SbBS512_A0288 YP_001883291.1 transposase subfamily VFG1603 Protein 7e-26 90
SbBS512_A0288 YP_001883291.1 transposase subfamily VFG1717 Protein 5e-25 89