Gene Information

Name : spaP (SbBS512_A0187)
Accession : YP_001883216.1
Strain :
Genome accession: NC_010660
Putative virulence/resistance : Virulence
Product : surface presentation of antigens protein SpaP
Function : -
COG functional category : U : Intracellular trafficking, secretion and vesicular transport
COG ID : COG4790
EC number : -
Position : 127969 - 128619 bp
Length : 651 bp
Strand : +
Note : part of a type III secretory system probably involved in invasion into eukaryotic cells

DNA sequence :
ATGCTGAGTGATATGTCCCTCATCGCTACACTTTCTTTTTTTACGCTATTACCATTTTTAGTTGCTGCTGGTACTTGTTA
TATAAAGTTTTCTATTGTTTTTGTAATGGTACGAAATGCACTTGGTTTGCAGCAGGTTCCATCAAATATGACTCTCAATG
GTATTGCATTGATTATGGCTTTGTTCGTGATGAAACCCATTATTGAAGCTGGTTATGAAAATTATCTAAATGGCCCGCAA
AAATTTGATACAATATCAGATATTGTCCGTTTTTCTGATTCTGGCTTGATTGAATACAAGCAATACTTGAAAAAGCATAC
AGATCTTGAGTTGGCACGTTTTTTCCAAAGGTCTGAAGAAGAAAATGCTGATTTAAAGAGTGCAGAGAATAATGATTATT
CATTGTTTTCCCTCTTGCCTGCATATGCGCTAAGTGAAATTAAAGATGCGTTCAAAATAGGTTTTTATTTATATTTGCCA
TTTATTGTTGTTGATCTTGTTATTTCAAGCATTTTACTTGCACTTGGTATGATGATGATGAGTCCAATCACAATATCAGT
ACCAATAAAACTTGTATTATTTGTTGCGCTTGATGGGTGGGGGATCCTGTCTAAGGCCTTGATTGAACAATATATCAATG
TTCCTGCTTAG

Protein sequence :
MLSDMSLIATLSFFTLLPFLVAAGTCYIKFSIVFVMVRNALGLQQVPSNMTLNGIALIMALFVMKPIIEAGYENYLNGPQ
KFDTISDIVRFSDSGLIEYKQYLKKHTDLELARFFQRSEEENADLKSAENNDYSLFSLLPAYALSEIKDAFKIGFYLYLP
FIVVDLVISSILLALGMMMMSPITISVPIKLVLFVALDGWGILSKALIEQYINVPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spaP NP_457284.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 3e-56 60
spaP NP_806493.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 3e-56 60
spaP YP_217809.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 1e-56 60
spaP NP_461811.1 surface presentation of antigens protein SpaP Virulence SPI-1 Protein 1e-56 60
spaP NP_311752.1 surface presentation of antigens protein SpaP Not tested LIM Protein 2e-62 60
epaP AAZ31293.1 EpaP Virulence ETT2 Protein 9e-61 59
spaP AAS66865.1 SpaP Not tested SSR-2 Protein 8e-64 59
ysaR AAS66846.1 YsaR Not tested SSR-1 Protein 3e-57 57
escR AAK26700.1 EscR Virulence LEE Protein 2e-39 45
escR YP_003223490.1 T3SS structure protein EscR Virulence LEE Protein 3e-39 45
escR AAL57527.1 EscR Virulence LEE Protein 2e-39 45
escR YP_003232138.1 type III secretion system protein Virulence LEE Protein 3e-39 45
escR CAC81847.1 EscR protein Virulence LEE II Protein 2e-39 45
escR CAI43889.1 EscR protein Virulence LEE Protein 2e-39 45
lscR AAO18040.1 LscR Virulence TTSS locus Protein 4e-37 44
escR ACU09473.1 type III secretion system protein EscR Virulence LEE Protein 2e-39 44
escR NP_290283.1 type III secretion system protein Virulence LEE Protein 3e-39 44
ECs4583 NP_312610.1 type III secretion system protein Virulence LEE Protein 2e-39 44
escR AAC38369.1 EscR Virulence LEE Protein 1e-38 44
escR AAC31528.1 L0049 Virulence LEE Protein 2e-39 44
escR YP_003236103.1 T3SS structure protein EscR Virulence LEE Protein 3e-39 44
unnamed AAL06354.1 EscR Virulence LEE Protein 1e-36 43
hrcR AAP34349.1 HrcR Virulence Hrp PAI Protein 2e-33 42
hrcR BAB07862.1 HrcR Virulence Hrp PAI Protein 1e-33 41
hrcR AAD21321.1 HrcR Virulence Hrp PAI Protein 8e-34 41
hrcR NP_640757.1 type III secretion system protein Virulence Hrp PAI Protein 1e-33 41
hrcR YP_362153.1 type III secretion system protein Virulence Hrp PAI Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
spaP YP_001883216.1 surface presentation of antigens protein SpaP VFG1012 Protein 8e-97 99
spaP YP_001883216.1 surface presentation of antigens protein SpaP VFG0551 Protein 5e-57 60
spaP YP_001883216.1 surface presentation of antigens protein SpaP VFG2455 Protein 5e-60 58
spaP YP_001883216.1 surface presentation of antigens protein SpaP VFG1773 Protein 9e-61 57
spaP YP_001883216.1 surface presentation of antigens protein SpaP VFG0394 Protein 2e-39 47
spaP YP_001883216.1 surface presentation of antigens protein SpaP VFG0715 Protein 5e-39 44
spaP YP_001883216.1 surface presentation of antigens protein SpaP VFG0827 Protein 1e-39 44
spaP YP_001883216.1 surface presentation of antigens protein SpaP VFG0188 Protein 3e-38 43