Gene Information

Name : SbBS512_E4765 (SbBS512_E4765)
Accession : YP_001882914.1
Strain : Shigella boydii CDC 3083-94
Genome accession: NC_010658
Putative virulence/resistance : Unknown
Product : transposase OrfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4446977 - 4447285 bp
Length : 309 bp
Strand : -
Note : identified by match to protein family HMM PF01527

DNA sequence :
ATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAAATACACGGTGGCAGA
TGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGTAAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAG
AATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGTGAACCGCCCCGGGAATCCTGGAGACTAA

Protein sequence :
MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRKLRKKLQRIEME
NEILKKATALLMSVNRPGNPGD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 8e-38 97
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 8e-38 97
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-34 94
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-36 94
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-29 75
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 75
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-29 75
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 75
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 75
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 75
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-29 75
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-29 75
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-26 68
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-21 59
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-21 59
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 3e-20 57
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-20 57
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-20 57
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-20 57
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-20 57
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-21 49
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-20 48
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SbBS512_E4765 YP_001882914.1 transposase OrfA VFG1485 Protein 3e-38 97
SbBS512_E4765 YP_001882914.1 transposase OrfA VFG1123 Protein 2e-29 75
SbBS512_E4765 YP_001882914.1 transposase OrfA VFG1553 Protein 6e-27 68
SbBS512_E4765 YP_001882914.1 transposase OrfA VFG0784 Protein 2e-20 57
SbBS512_E4765 YP_001882914.1 transposase OrfA VFG1566 Protein 9e-13 41