Gene Information

Name : SbBS512_E4662 (SbBS512_E4662)
Accession : YP_001882825.1
Strain : Shigella boydii CDC 3083-94
Genome accession: NC_010658
Putative virulence/resistance : Unknown
Product : site-specific recombinase, phage integrase family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 4357834 - 4358838 bp
Length : 1005 bp
Strand : -
Note : -

DNA sequence :
ATGGCACTGACTGACGCAAAAATCCGGGCTGCAAAGCCCACTGACAAGGCTTATAAACTCACTGACGGGGCTGGCATGTT
CCTGCTGGTACATCCTAATGGCTCCCGTTACTGGCGTCTCCGTTATCGTATTCTGGGTAAGGAGAAGACTCTGGCACTTG
GTGTGTATCCAGAAGTTTCTCTCTCCGAAGCTCGTACAAAACGGGATGAGGCCCGAAAACTGATTTCGGAGGGGGTTGAC
CCTTGCGAACAGAAAAGAGCTAAAAAAGTAGTCCCTGATTTACAGCTCTCTTTTGAACATATTGCGCGACGCTGGCATGC
CAGTAATAAACAATGGGCACAATCACACAGCGATAAAGTACTCAAAAGCCTCGAGACTCACGTTTTCCCCTTTATCGGCA
ACCGGGATATCACAACACTCAATACCCCGGATCTGCTTATCCCTGTTCGTGCTACAGAAGCTAAACAAATTTATGAAATC
GCCAGTCGTCTGCAGCAAAGAATATCTGCCGTAATGCGTTATGCCGTACAGTCTGGCATCATCAGATATAATCCTGCTCT
GGATATGGCTGGCGCATTGACTACGGTAAAACGCCAGCATCGCCCCGCTCTTGATCTTTCTCGCCTGCCTGAACTTTTGT
CGCGTATTGGCAGTTACAAAGGGCAACCTGTCACCCAGCTTGCCGTTATGCTGAATTTACTGGTTTTTATTCGTTCCAGT
GAACTCAGATACGCCCGCTGGTCTGAAATTGATATTGACAATGCCATGTGGACTATTCCAGCCGAACGCGAACCCCTGCC
AGGCGTAAAATTCTCACACCGGGGCTCCAAGATGCGAACACCACATCTTGTGCCACTCAGCAAACAGGCTGTAGCCATAC
TGACAGAACTACAGACATGGGCTGGTGAAAATGGTCTGATCTTTACGGGAGCACATGACCCGCGTAAACCAATCAGTGAA
AATGTAATGAACGCATCTCACACAATTAAACACGGAGCAGTATGA

Protein sequence :
MALTDAKIRAAKPTDKAYKLTDGAGMFLLVHPNGSRYWRLRYRILGKEKTLALGVYPEVSLSEARTKRDEARKLISEGVD
PCEQKRAKKVVPDLQLSFEHIARRWHASNKQWAQSHSDKVLKSLETHVFPFIGNRDITTLNTPDLLIPVRATEAKQIYEI
ASRLQQRISAVMRYAVQSGIIRYNPALDMAGALTTVKRQHRPALDLSRLPELLSRIGSYKGQPVTQLAVMLNLLVFIRSS
ELRYARWSEIDIDNAMWTIPAEREPLPGVKFSHRGSKMRTPHLVPLSKQAVAILTELQTWAGENGLIFTGAHDPRKPISE
NVMNASHTIKHGAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 7e-151 99
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 2e-150 98
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 2e-150 98
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 8e-150 98
int AAL51003.1 CP4-like integrase Not tested LEE Protein 8e-150 98
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 1e-150 98
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 1e-150 98
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 1e-150 98
int AAL51028.1 CP4-like integrase Not tested LEE Protein 1e-150 98
int-phe AAL60261.1 Int-phe Not tested LEE Protein 1e-150 98
int CAC81896.1 integrase Not tested LEE II Protein 2e-139 98
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 2e-147 97
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 2e-149 97
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 1e-149 97
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 9e-149 97
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 3e-149 97
int AAK16198.1 Int Not tested PAI-I AL862 Protein 2e-149 97
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 4e-149 96
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 4e-149 96
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 5e-147 96
int AAK00456.1 Int Not tested SHI-1 Protein 4e-138 96
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 4e-92 59
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 3e-91 56
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 3e-91 56
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 2e-78 51
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 2e-78 51
int CAB59974.1 integrase Not tested HPI Protein 8e-73 50
int YP_002346908.1 integrase Not tested HPI Protein 7e-72 50
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 7e-72 50
int2 NP_993013.1 integrase Not tested HPI Protein 7e-72 50
int CAA08754.1 integrase Not tested HPI Protein 5e-72 50
int CAA21384.1 - Not tested HPI Protein 7e-72 50
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 2e-81 49
unnamed AAD17660.1 unknown Not tested HPI Protein 2e-70 49
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 4e-46 47
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 6e-67 46
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 1e-51 46
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 2e-63 44
int AAD44730.1 Int Not tested SHI-2 Protein 2e-70 43
aec33 AAW51716.1 Int Not tested AGI-3 Protein 6e-71 43
int CAC39282.1 integrase Not tested LPA Protein 6e-71 43
ESA_03025 YP_001439090.1 hypothetical protein Not tested Not named Protein 5e-61 42
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 6e-69 42
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 8e-69 42
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 8e-69 42
int AAC31482.1 CP4-like integrase Not tested LEE Protein 5e-69 41
int ACU09430.1 integrase Not tested LEE Protein 5e-69 41
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 6e-69 41
ECs4534 NP_312561.1 integrase Not tested LEE Protein 6e-69 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SbBS512_E4662 YP_001882825.1 site-specific recombinase, phage integrase family protein VFG1693 Protein 4e-149 97
SbBS512_E4662 YP_001882825.1 site-specific recombinase, phage integrase family protein VFG0626 Protein 2e-149 96
SbBS512_E4662 YP_001882825.1 site-specific recombinase, phage integrase family protein VFG1536 Protein 2e-92 59
SbBS512_E4662 YP_001882825.1 site-specific recombinase, phage integrase family protein VFG0598 Protein 3e-69 42
SbBS512_E4662 YP_001882825.1 site-specific recombinase, phage integrase family protein VFG0783 Protein 3e-69 41