Gene Information

Name : SbBS512_E3898 (SbBS512_E3898)
Accession : YP_001882187.1
Strain : Shigella boydii CDC 3083-94
Genome accession: NC_010658
Putative virulence/resistance : Unknown
Product : IS66 family transposase orfB
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3625936 - 3626286 bp
Length : 351 bp
Strand : +
Note : identified by match to protein family HMM PF05717

DNA sequence : 
ATGATCTCACACCCGTCAGGCACCCGCATCTGGCTCGTTGCTGGGATAACCGATATGCGTAAGTCTTTCAACGGGCTGGG
TGAACAGGTACAGCATGTGCTGAATGATAATCCCTTCTCCGGTCACCTGTTCATCTTCCGTGGCCGACGGGGTGACATGA
TTAAAATCCTGTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAGACGCCTGGAGGAAGGCCAGTTTATCTGGCCTGCT
GTGCGTGACGGCAAGGTATCCATTACCCGCTCACAACTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAAAC
ATCCCGCCTTAACGCACTGACAATGTTGTAA

Protein sequence : 
MISHPSGTRIWLVAGITDMRKSFNGLGEQVQHVLNDNPFSGHLFIFRGRRGDMIKILWADADGLCLFTRRLEEGQFIWPA
VRDGKVSITRSQLAMLLDKLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-47 95
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-47 95
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-48 95
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-48 95
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-48 94
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-38 70
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-38 70
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-37 69
unnamed AAL08461.1 unknown Not tested SRL Protein 9e-35 66
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-34 65
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-34 65
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-34 65
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-34 65
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-34 65
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-34 65
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-34 65
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-34 65
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-34 65
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-34 65
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 5e-26 65
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-33 64
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-33 64
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-35 63
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-35 63
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-27 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SbBS512_E3898 YP_001882187.1 IS66 family transposase orfB VFG1737 Protein 7e-49 94
SbBS512_E3898 YP_001882187.1 IS66 family transposase orfB VFG1665 Protein 6e-38 69
SbBS512_E3898 YP_001882187.1 IS66 family transposase orfB VFG1052 Protein 4e-35 66
SbBS512_E3898 YP_001882187.1 IS66 family transposase orfB VFG1709 Protein 5e-35 65
SbBS512_E3898 YP_001882187.1 IS66 family transposase orfB VFG0792 Protein 5e-35 65
SbBS512_E3898 YP_001882187.1 IS66 family transposase orfB VFG1698 Protein 7e-35 65
SbBS512_E3898 YP_001882187.1 IS66 family transposase orfB VFG1517 Protein 2e-26 65