Gene Information

Name : arsR (SbBS512_E3820)
Accession : YP_001882113.1
Strain : Shigella boydii CDC 3083-94
Genome accession: NC_010658
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional repressor ArsR
Function : -
COG functional category : K : Transcription
COG ID : COG0640
EC number : -
Position : 3546236 - 3546589 bp
Length : 354 bp
Strand : -
Note : regulates the expression of of the arsRBC involved in resistance to arsenic

DNA sequence :
ATGTCATTTCTGTTACCCATCCAATTGTTCAAAATTCTTGCTGATGAAACCCGTCTGGGCATCGTTTTACTGCTCAGCGA
ACTGGGAGAGTTATGCGTCTGCGATCTCTGCACTGCTCTCGACCAGTCGCAGCCCAAGATCTCCCGCCACCTGGCATTGC
TGCGTGAAAGCGGGCTATTGCTGGACCGCAAGCAAGGTAAATGGGTTCATTACCGCTTATCGCCGCATATTCCAGCATGG
GCGGCGAAAATAATTGATGAAGCCTGGCGATGTGAACAGGAAAAGATTCAGGCAATTGTCCGCAACCTGGCTCGACAAAA
CTGTTCCGCAGACAGTAAGAACATTTACAGTTAA

Protein sequence :
MSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHYRLSPHIPAW
AAKIIDEAWRCEQEKIQAIVRNLARQNCSADSKNIYS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR2 YP_001007630.1 DNA-binding transcriptional repressor ArsR Not tested YAPI Protein 1e-37 72

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arsR YP_001882113.1 DNA-binding transcriptional repressor ArsR BAC0594 Protein 7e-49 98
arsR YP_001882113.1 DNA-binding transcriptional repressor ArsR BAC0589 Protein 1e-38 75
arsR YP_001882113.1 DNA-binding transcriptional repressor ArsR BAC0591 Protein 7e-39 72
arsR YP_001882113.1 DNA-binding transcriptional repressor ArsR BAC0588 Protein 2e-30 71