Gene Information

Name : SbBS512_E2307 (SbBS512_E2307)
Accession : YP_001880802.1
Strain : Shigella boydii CDC 3083-94
Genome accession: NC_010658
Putative virulence/resistance : Unknown
Product : IS911, transposase orfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2097471 - 2097773 bp
Length : 303 bp
Strand : +
Note : identified by match to protein family HMM PF01527

DNA sequence :
ATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGAAATACACGGTGGCAGA
TGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGTAAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAG
AATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACTGTTCTCGATAA

Protein sequence :
MKKRNFSAEFKRESAQLVVDQKYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRKLRKKLQRIEME
NEILKKATALLMSDSLNCSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-40 96
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-40 96
api80 CAF28554.1 putative transposase Not tested YAPI Protein 5e-34 94
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-38 93
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-30 76
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-30 76
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-30 76
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-30 76
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-30 76
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-30 76
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-30 76
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-30 76
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-29 70
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-22 61
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 7e-23 61
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-21 59
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-21 59
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-21 59
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-21 59
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-21 56
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-20 49
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 6e-20 48
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-12 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SbBS512_E2307 YP_001880802.1 IS911, transposase orfA VFG1485 Protein 1e-40 96
SbBS512_E2307 YP_001880802.1 IS911, transposase orfA VFG1123 Protein 8e-31 76
SbBS512_E2307 YP_001880802.1 IS911, transposase orfA VFG1553 Protein 2e-29 70
SbBS512_E2307 YP_001880802.1 IS911, transposase orfA VFG0784 Protein 8e-22 59
SbBS512_E2307 YP_001880802.1 IS911, transposase orfA VFG1566 Protein 1e-12 42