Gene Information

Name : SbBS512_E2108 (SbBS512_E2108)
Accession : YP_001880637.1
Strain : Shigella boydii CDC 3083-94
Genome accession: NC_010658
Putative virulence/resistance : Unknown
Product : IS66 family element, orf2
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1916463 - 1916756 bp
Length : 294 bp
Strand : +
Note : identified by match to protein family HMM PF05717

DNA sequence :
ATGAGAAATGGCTTCAACGGCCTGGCGGCAAAGGTGCAGACGACGCTGAAAGACGATCCGATGTCAGGTCACGTTTTTAT
CTTCCGTGGGCGTAATGGCAGTCAGGTAAAGCTCCTCTGGTCTACCGGCGATGGACTGTGTCTGCTGACCAAACGGCTGG
AGCGCGGCCGCTTCGCCTGGCCGTCAGCCCGGGATGGCAAAGTGTTCCTCACACCGGCACAGCTGGCGATGCTCCTTGAA
GGTATCGACTGGCGGCAGCCTAAAAGACTGCTTACGTCCCTGACTATGTTGTAA

Protein sequence :
MRNGFNGLAAKVQTTLKDDPMSGHVFIFRGRNGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTPAQLAMLLE
GIDWRQPKRLLTSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-40 100
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-40 100
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-40 97
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-40 97
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-40 97
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-39 97
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-39 97
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-40 97
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-40 97
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-40 97
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-40 97
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-40 97
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-27 96
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-39 95
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-32 77
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-32 77
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-31 76
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-30 72
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-30 72
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-23 70
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-26 63
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-26 63
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-27 62
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-27 62
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-27 61

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SbBS512_E2108 YP_001880637.1 IS66 family element, orf2 VFG1698 Protein 3e-41 100
SbBS512_E2108 YP_001880637.1 IS66 family element, orf2 VFG0792 Protein 2e-40 97
SbBS512_E2108 YP_001880637.1 IS66 family element, orf2 VFG1709 Protein 2e-40 97
SbBS512_E2108 YP_001880637.1 IS66 family element, orf2 VFG1517 Protein 7e-28 96
SbBS512_E2108 YP_001880637.1 IS66 family element, orf2 VFG1052 Protein 4e-40 95
SbBS512_E2108 YP_001880637.1 IS66 family element, orf2 VFG1665 Protein 5e-32 76
SbBS512_E2108 YP_001880637.1 IS66 family element, orf2 VFG1737 Protein 1e-27 61