Gene Information

Name : SbBS512_E1126 (SbBS512_E1126)
Accession : YP_001879775.1
Strain : Shigella boydii CDC 3083-94
Genome accession: NC_010658
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1022241 - 1022462 bp
Length : 222 bp
Strand : +
Note : identified by match to protein family HMM PF06174

DNA sequence :
ATGAAAATTATCACCCGTGGTGAAGCCATGCGTATTCACCAACAACATCCGACATCCCGTCTTTTTCCGTTCTGTACCGG
TAAATACCGCTGGCACGGCAGTGCTGAAGCGTATACCGGTCGTGAAGTGCAGGATATTCCCGGTGTGCTGGCCGTGTTTG
CTGAACGCCGTAAGGACAGTTTTGGTCCGTATGTCCGGCTGATGAGCGTCACCCTGAACTGA

Protein sequence :
MKIITRGEAMRIHQQHPTSRLFPFCTGKYRWHGSAEAYTGREVQDIPGVLAVFAERRKDSFGPYVRLMSVTLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeT CAD33788.1 YeeT protein Not tested PAI I 536 Protein 4e-31 100
yeeT ADD91701.1 YeeT Not tested PAI-I AL862 Protein 4e-31 99
yeeT AAZ04459.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 6e-31 98
Z1218 NP_286753.1 hypothetical protein Not tested TAI Protein 1e-30 98
c5151 NP_756999.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-31 98
unnamed AAL08476.1 unknown Not tested SRL Protein 8e-31 98
ECO103_3590 YP_003223447.1 hypothetical protein Not tested LEE Protein 3e-30 96
yeeT CAE85202.1 YeeT protein Not tested PAI V 536 Protein 2e-30 96
unnamed CAD66204.1 hypothetical protein Not tested PAI III 536 Protein 2e-30 96
unnamed CAI43847.1 hypothetical protein Not tested LEE Protein 1e-30 96
unnamed AAL57578.1 unknown Not tested LEE Protein 1e-28 96
unnamed AAL67344.1 intergenic-region protein Not tested PAI II CFT073 Protein 7e-31 96
unnamed CAI43902.1 hypothetical protein Not tested LEE Protein 1e-28 96
aec74 AAW51757.1 Aec74 Not tested AGI-3 Protein 2e-30 95
yeeT AAK16199.1 YeeT Not tested PAI-I AL862 Protein 8e-31 95
yeeT CAD42099.1 hypothetical protein Not tested PAI II 536 Protein 2e-30 94
yeeT NP_838485.1 hypothetical protein Not tested SHI-1 Protein 3e-30 94
yeeT NP_708771.1 hypothetical protein Not tested SHI-1 Protein 3e-30 94
unnamed AAK00480.1 unknown Not tested SHI-1 Protein 3e-26 93

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SbBS512_E1126 YP_001879775.1 hypothetical protein VFG1529 Protein 1e-31 100
SbBS512_E1126 YP_001879775.1 hypothetical protein VFG1067 Protein 3e-31 98
SbBS512_E1126 YP_001879775.1 hypothetical protein VFG1679 Protein 6e-31 96
SbBS512_E1126 YP_001879775.1 hypothetical protein VFG0661 Protein 8e-31 94
SbBS512_E1126 YP_001879775.1 hypothetical protein VFG1618 Protein 8e-31 94