Gene Information

Name : YPTS_0820 (YPTS_0820)
Accession : YP_001871261.1
Strain : Yersinia pseudotuberculosis PB1/+
Genome accession: NC_010634
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional repressor ArsR
Function : -
COG functional category : K : Transcription
COG ID : COG0640
EC number : -
Position : 924888 - 925229 bp
Length : 342 bp
Strand : -
Note : regulates the expression of of the arsRBC involved in resistance to arsenic

DNA sequence :
ATGACAACACTCACGCCGTTGCAACTTTTTAAGAACTTATCGGATGAAACACGTCTGAATATTATCTTATTGCTAAAAGC
ATCCGGCGAACTGTGTGTTTGTGAGCTTTGCCATCGCTTAAATGAAGCCCAACCCAAGATTTCCAGGCATTTAGCCATGC
TAAGAGAGTCCGGGCTGTTACTGGATCGCCGGGCAGGGAAATGGGTCCACTACCGCCTGTCGCCCCATATTCCAGCTTGG
GCCGCAGCCATCATCGAGCAAACTTATCTCAGCCAACGCGATGAAATAACGTTACTGGCGCAGGGTAACGTCACTCCCGA
CAGCAAAATGTTGTGTAACTAA

Protein sequence :
MTTLTPLQLFKNLSDETRLNIILLLKASGELCVCELCHRLNEAQPKISRHLAMLRESGLLLDRRAGKWVHYRLSPHIPAW
AAAIIEQTYLSQRDEITLLAQGNVTPDSKMLCN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR2 YP_001007630.1 DNA-binding transcriptional repressor ArsR Not tested YAPI Protein 1e-33 67
arsR CAJ77018.1 arsenite inducible repressor Not tested AbaR1 Protein 4e-20 50
arsR AFC76435.1 ArsR Not tested AbaR5 Protein 6e-20 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YPTS_0820 YP_001871261.1 DNA-binding transcriptional repressor ArsR BAC0589 Protein 8e-35 69
YPTS_0820 YP_001871261.1 DNA-binding transcriptional repressor ArsR BAC0588 Protein 1e-27 68
YPTS_0820 YP_001871261.1 DNA-binding transcriptional repressor ArsR BAC0591 Protein 2e-33 63
YPTS_0820 YP_001871261.1 DNA-binding transcriptional repressor ArsR BAC0594 Protein 2e-31 61